Detailed information of regulator


Summary

Regulator ID REG0208 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS regulatory pathway
KEGG pathway (determined by BlastKOALA) Metabolic pathways (map01100); Biosynthesis of secondary metabolites (map01110); Microbial metabolism in diverse environments (map01120); Biosynthesis of cofactors (map01240); Porphyrin and chlorophyll metabolism (map00860)
Related T6SS T6SS00372 experimental (Type i4b)
Strain Edwardsiella tarda EIB202
Replicon chromosome
Sequence Protein sequence (341 a.a.); Nucleotide sequence (1023 bp)
Description Putative repressors of esrB as identified by Tn-seq.
Reference

External database links

Locus tag (Gene) ETAE_0154 (hemB)
Coordinates (Strand) 159867..160889 (+)
NCBI ID 502610017
RefSeq NC_013508
Uniprot ID D0Z9R1_EDWTE, A0A076LK89_9GAMM, A0A0H3DP07_EDWTF
KEGG ID ete:ETEE_1915, etd:ETAF_0127, etr:ETAE_0154
KEGG pathway (determined by BlastKOALA) map01100; map01110; map01120; map01240; map00860
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
ETAE_0886 (esrB) promoter -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
ALAD PF00490.23 8.2e-137 12..332

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-340 VSYAFPGAFPGRRLRRLRRHDFSRRLCAENVLTVDDLIYPVFVMEGNNHQEAVSSMPGVQRMTIDVLVREAEAVAKLGVPVLSLFPVVGTDKKSLYAEEAYSSDGLVQRAVRALKDAVPELGILTDVALDPYTTHGQDGVIDEDGYVVNDITKEILVRQALSHAEAGADIVAPSDMMDGRIGAIRSMLESQKLVNTQIMAYSAKYASCYYGPFRDALGSSGNLKGGNKKTYQMDPANGDEALQEVAQDLQEGADMVMVKPGMPYLDVLRRVKDTFGVPTFAYQVSGEYAMHMAAIQNGWLQEKPAIMESLICFKRAGADGVLTYFAKRVAQWLHDAEMTR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9933 - -



  Protein sequence of regulator: 341 a.a.    .

>REG0208 NC_013508:159867-160889 [Edwardsiella tarda EIB202]
VSYAFPGAFPGRRLRRLRRHDFSRRLCAENVLTVDDLIYPVFVMEGNNHQEAVSSMPGVQRMTIDVLVREAEAVAKLGVP
VLSLFPVVGTDKKSLYAEEAYSSDGLVQRAVRALKDAVPELGILTDVALDPYTTHGQDGVIDEDGYVVNDITKEILVRQA
LSHAEAGADIVAPSDMMDGRIGAIRSMLESQKLVNTQIMAYSAKYASCYYGPFRDALGSSGNLKGGNKKTYQMDPANGDE
ALQEVAQDLQEGADMVMVKPGMPYLDVLRRVKDTFGVPTFAYQVSGEYAMHMAAIQNGWLQEKPAIMESLICFKRAGADG
VLTYFAKRVAQWLHDAEMTR*

  Nucleotide sequence of regulator: 1023 bp    .

>REG0208 NC_013508:159867-160889 [Edwardsiella tarda EIB202]
GTGAGCTATGCATTTCCAGGCGCCTTTCCGGGGCGTCGCCTGCGCCGTCTGCGCCGGCATGATTTTAGTCGCCGTCTGTG
TGCCGAAAACGTGCTGACGGTTGACGATCTGATCTATCCGGTGTTTGTGATGGAGGGGAACAACCATCAGGAGGCGGTCT
CCTCCATGCCGGGGGTTCAGCGCATGACCATCGATGTCCTGGTTCGTGAGGCCGAGGCCGTCGCTAAGCTGGGCGTGCCG
GTGCTGTCGCTGTTCCCGGTGGTCGGTACGGATAAAAAATCGCTGTATGCCGAAGAGGCGTACAGCAGCGATGGTCTGGT
GCAGCGCGCGGTGCGGGCTCTGAAGGATGCGGTGCCTGAGCTTGGCATCTTAACCGACGTCGCGCTGGATCCGTATACGA
CGCACGGCCAGGATGGCGTGATCGATGAGGACGGCTACGTCGTCAACGATATCACGAAAGAGATCCTGGTGCGTCAGGCC
TTATCCCATGCCGAGGCCGGTGCCGATATCGTGGCGCCGAGCGATATGATGGATGGCCGCATTGGCGCTATCCGCAGCAT
GCTGGAGAGCCAAAAGCTGGTCAATACCCAGATCATGGCTTACTCCGCGAAGTATGCCTCTTGCTACTACGGTCCGTTCC
GCGATGCGCTGGGCTCCTCTGGGAACCTGAAGGGCGGCAACAAGAAAACCTATCAGATGGACCCGGCTAACGGGGATGAG
GCGCTGCAGGAGGTGGCTCAGGATCTGCAGGAGGGGGCCGATATGGTGATGGTTAAACCAGGTATGCCGTATCTGGACGT
ATTACGCCGAGTGAAAGATACCTTTGGCGTGCCGACCTTCGCCTATCAGGTCTCCGGTGAGTATGCCATGCATATGGCTG
CGATCCAGAACGGTTGGCTGCAGGAGAAGCCGGCGATCATGGAGTCCCTGATTTGCTTCAAGCGGGCGGGCGCCGATGGC
GTGCTGACCTATTTTGCCAAGCGTGTGGCACAGTGGCTGCATGATGCAGAGATGACGCGCTGA