Detailed information of regulator


Summary

Regulator ID REG0202 experimental
Regulator type protein
Regulatory pathway (from literatures) Unknown
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Biofilm formation - Pseudomonas aeruginosa (map02025)
Related T6SS T6SS00287 experimental (Type i4b)
Strain Xanthomonas oryzae pv. oryzae PXO99A
Replicon chromosome
Sequence Protein sequence (129 a.a.); Nucleotide sequence (387 bp)
Description -
Reference
[1]

External database links

Locus tag (Gene) PXO_RS20535
Coordinates (Strand) 4488457..4488843 (-)
NCBI ID 499576999
RefSeq NC_010717
Uniprot ID A0A0K0GPS7_XANOP, A0A0U4VVJ3_XANOO
KEGG ID xop:PXO_02637
KEGG pathway (determined by BlastKOALA) map02020; map02025
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
Unknown -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Response_reg PF00072.26 1.3e-26 4..114

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-128 MARILIVDDSPSQLLGIQRIVEKLGHETIIATDGAAGVEAAKESLPDLVLMDVVMPNLNGFQATRTLKREPTTQHIPVILVTTKDQDTDRMWGMRQGARAYITKPFSEDELLEVMERVFNQKDETPKA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9977 - -



  Protein sequence of regulator: 129 a.a.    .

>REG0202 NC_010717:c4488843-4488457 [Xanthomonas oryzae pv. oryzae PXO99A]
MARILIVDDSPSQLLGIQRIVEKLGHETIIATDGAAGVEAAKESLPDLVLMDVVMPNLNGFQATRTLKREPTTQHIPVIL
VTTKDQDTDRMWGMRQGARAYITKPFSEDELLEVMERVFNQKDETPKA*

  Nucleotide sequence of regulator: 387 bp    .

>REG0202 NC_010717:c4488843-4488457 [Xanthomonas oryzae pv. oryzae PXO99A]
ATGGCACGTATTTTGATCGTCGACGACTCACCGTCCCAACTGCTGGGGATTCAGCGCATCGTGGAGAAGCTGGGGCACGA
AACCATCATCGCCACCGATGGGGCAGCGGGCGTAGAAGCGGCCAAGGAATCGCTGCCCGATTTGGTGCTTATGGATGTGG
TGATGCCTAACCTCAACGGGTTCCAGGCCACACGCACACTCAAGCGCGAGCCCACCACCCAGCACATTCCGGTGATCCTG
GTCACCACCAAGGATCAGGACACCGACCGTATGTGGGGCATGCGCCAAGGCGCCCGCGCCTACATCACCAAGCCGTTTTC
AGAAGATGAACTGCTGGAAGTGATGGAGCGCGTGTTCAATCAGAAAGACGAAACGCCGAAAGCATAG