Detailed information of regulator


Summary

Regulator ID REG0199 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS-RR
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Biofilm formation - Escherichia coli (map02026)
Related T6SS T6SS00260 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (240 a.a.); Nucleotide sequence (720 bp)
Description EMSA assay results indicate that OmpR directly binds to the T6SS4 promoter through recognizing the O1, O2 and O3 elements and T6SS4p::lacZ fusion LacZ activity results demonstrate that the T6SS4 expression is positively regulated by OmpR through recognizing O1,O2 and O3 elements in an unknown mechanism.
Reference

External database links

Locus tag (Gene) YPK_RS00840 (OmpR)
Coordinates (Strand) 223260..223979 (+)
NCBI ID 488137706
RefSeq NC_010465
Uniprot ID Q664K5_YERPS, A0A0E1NRY8_YERPA, A0A0H2YMD5_YERPN, A0A0H3AYZ6_YERPY
KEGG ID ypa:YPA_3333, ypy:YPK_0172, ypo:BZ17_2821, ypn:YPN_3929, yps:YPTB3764
KEGG pathway (determined by BlastKOALA) map02020; map02026
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
T6SS4 promoter -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Response_reg PF00072.26 1.5e-29 7..117
Trans_reg_C PF00486.30 2.4e-22 157..232

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-239 MQENHKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPGEDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVLRRQANELPGAPSQEEAIIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGNKA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9985 - -



  Protein sequence of regulator: 240 a.a.    .

>REG0199 NC_010465:223260-223979 [Yersinia pseudotuberculosis YPIII]
MQENHKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPGEDGLSICRRLRSQSNPMPII
MVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVLRRQANELPGAPSQEEAIIAFGKFKLNLGTREMFREDEPMP
LTSGEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGNKA*

  Nucleotide sequence of regulator: 720 bp    .

>REG0199 NC_010465:223260-223979 [Yersinia pseudotuberculosis YPIII]
ATGCAAGAGAATCACAAGATTCTGGTCGTTGATGACGATATGCGTCTACGTGCGCTACTCGAACGTTATTTGACGGAGCA
AGGTTTTCAGGTCCGCAGTGTGGCTAATGCTGAACAGATGGATCGCTTGCTGACTCGTGAGTCCTTCCACCTGATGGTAC
TTGACCTGATGTTACCGGGCGAAGATGGTTTGTCGATTTGCCGCCGCTTGCGTAGTCAAAGTAATCCGATGCCGATCATT
ATGGTGACGGCAAAAGGCGAAGAAGTGGACCGTATCGTTGGGCTGGAAATCGGTGCGGATGATTATATTCCCAAGCCATT
CAACCCTCGCGAATTACTGGCTCGTATCCGTGCGGTACTGCGCCGTCAGGCAAACGAACTGCCGGGAGCGCCTTCACAAG
AAGAGGCGATCATTGCGTTTGGCAAATTTAAACTGAATCTGGGCACGCGCGAGATGTTTCGTGAAGATGAGCCTATGCCA
CTGACTAGCGGTGAATTTGCGGTGCTTAAAGCCTTGGTTAGCCACCCACGTGAGCCGTTGTCCCGCGATAAGCTGATGAA
TCTGGCCCGTGGCCGTGAATACAGTGCGATGGAACGTTCTATCGATGTCCAGATTTCTCGTTTGCGTCGGATGGTGGAAG
AAGATCCGGCCCATCCGCGTTATATCCAGACGGTGTGGGGTCTAGGCTACGTCTTTGTACCGGACGGCAATAAAGCATGA