Detailed information of regulator


Summary

Regulator ID REG0196 experimental
Regulator type protein
Regulatory pathway (from literatures) QS regulatory pathway
KEGG pathway (determined by BlastKOALA) Quorum sensing (map02024)
Related T6SS T6SS00256 insolico (Type i1)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (248 a.a.); Nucleotide sequence (744 bp)
Description the expression of T6SS1 was upregulated in the ypsIytbI and ypsRytbR double mutants compared to the YPIII parent strain.
Reference

External database links

Locus tag (Gene) YPK_RS03965 (YtbR)
Coordinates (Strand) 900476..901219 (+)
NCBI ID 488140447
RefSeq NC_010465
Uniprot ID I3NIA6_YERPS, A0A0U1QWI7_YERP3, A0A0E1NR40_YERPA, A0A0H2YKJ1_YERPN, A0A0H3B1V3_YERPY, O85822_YERPU
KEGG ID ypy:YPK_0791, ypo:BZ17_3352, yps:YPTB3259, ypa:YPA_0279, ypc:BZ23_2819, ypn:YPN_3183, ypr:BZ20_2856, ypi:YpsIP31758_0720, ypu:BZ21_2538, ypq:DJ40_3179
KEGG pathway (determined by BlastKOALA) map02024
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
T6SS transcripts -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Autoind_bind PF03472.17 7.3e-31 13..157
GerE PF00196.21 2e-15 181..233

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-247 MHSVFNRSNEVIETLRDYIDRKLTIYDSPKYTYMVINKKNPGDIFIVTSYPNEWAELYTNNNYQNIDPVVLIAFRRFSPFSWDENITVLSELKLSKIFTLSKKYNIVNGFTFVLHDTMNNLAMLSLIMDDSALNGVESRVLNDRDRLQMLLIETHEKMLTLSQRNMNIQERQGKGMPGKAILSPRENEVLYWASMGKTYQEIAIITNITPRTVKYHIGNVVKKLGVINAKQAIGLGVELEIIKPILA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9876 - -



  Protein sequence of regulator: 248 a.a.    .

>REG0196 NC_010465:900476-901219 [Yersinia pseudotuberculosis YPIII]
MHSVFNRSNEVIETLRDYIDRKLTIYDSPKYTYMVINKKNPGDIFIVTSYPNEWAELYTNNNYQNIDPVVLIAFRRFSPF
SWDENITVLSELKLSKIFTLSKKYNIVNGFTFVLHDTMNNLAMLSLIMDDSALNGVESRVLNDRDRLQMLLIETHEKMLT
LSQRNMNIQERQGKGMPGKAILSPRENEVLYWASMGKTYQEIAIITNITPRTVKYHIGNVVKKLGVINAKQAIGLGVELE
IIKPILA*

  Nucleotide sequence of regulator: 744 bp    .

>REG0196 NC_010465:900476-901219 [Yersinia pseudotuberculosis YPIII]
ATGCATTCTGTTTTCAATAGGAGTAACGAGGTAATAGAAACACTGCGTGATTATATCGACAGAAAACTTACCATCTACGA
CAGTCCAAAATATACCTATATGGTGATCAATAAAAAGAATCCAGGCGATATTTTCATTGTCACTAGCTACCCAAATGAAT
GGGCTGAACTCTATACAAATAATAACTACCAGAATATAGATCCTGTTGTCCTGATCGCTTTCAGGCGGTTCTCTCCGTTC
TCTTGGGATGAAAATATTACTGTCCTTTCTGAACTGAAATTATCAAAAATCTTCACACTCTCTAAGAAATATAACATTGT
TAATGGTTTCACTTTTGTTCTGCACGATACGATGAATAATTTGGCAATGTTGTCACTCATTATGGATGATAGTGCTCTGA
ATGGAGTAGAAAGTAGAGTGTTGAATGATAGGGACAGGCTACAAATGCTCCTGATAGAAACCCATGAAAAGATGCTTACA
TTGAGTCAAAGAAATATGAATATCCAGGAACGCCAGGGGAAAGGTATGCCCGGTAAAGCCATTCTATCCCCGCGAGAAAA
TGAAGTGCTCTACTGGGCCAGCATGGGAAAAACCTATCAAGAGATTGCCATAATCACAAATATCACCCCCAGAACAGTAA
AATATCACATAGGAAATGTGGTAAAAAAGTTGGGTGTAATTAACGCAAAACAGGCAATCGGGCTTGGTGTTGAACTGGAA
ATTATTAAGCCGATTCTGGCATAA