Detailed information of regulator


Summary

Regulator ID REG0195 experimental
Regulator type protein
Regulatory pathway (from literatures) QS regulatory pathway
KEGG pathway (determined by BlastKOALA) Quorum sensing (map02024)
Related T6SS T6SS00256 insolico (Type i1)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (246 a.a.); Nucleotide sequence (738 bp)
Description the expression of T6SS1 was upregulated in the ypsIytbI and ypsRytbR double mutants compared to the YPIII parent strain.
Reference

External database links

Locus tag (Gene) YPK_RS08345 (YpsR)
Coordinates (Strand) 1837676..1838413 (+)
NCBI ID 488140651
RefSeq NC_010465
Uniprot ID Q669I5_YERPS, A0A0U1QYW0_YERP3, A0A0E1NR16_YERPA, A0A0H2YHM1_YERPN, A0A0H3B295_YERPY, Q9RH45_YERPE
KEGG ID ypn:YPN_2053, ypw:CH59_4287, ypv:BZ15_1073, ype:YPO2457, ypy:YPK_1655, ypa:YPA_1955, ypl:CH46_2653, ypi:YpsIP31758_1547, yps:YPTB2500, ypj:CH55_153, ypo:BZ17_4139
KEGG pathway (determined by BlastKOALA) map02024
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
T6SS transcripts -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Autoind_bind PF03472.17 4.2e-27 13..157
GerE PF00196.21 8.5e-16 181..235

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-245 MIINFFDNESINEDIKNYIQRRIKAYGNIRYSYLLMNKKVPLHPAIISNYPLDWVKKYKKNSYHLIDPVILTAKGKVAPFAWDDNSVINIKSTDSAVFNLAREYNIVNGYTFVLHDNNNNMATLNVSSGDDDSIFFDESIEVNKEKIQMLLIFIHDKMLGLYNKSHHENNTLNKKENKREIFSPRENEILYWASVGKTYSEIAIILGIKKSTVKFHIGNIVRKLGVLNAKHAIRLGIELQLIKPI



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9882 - -



  Protein sequence of regulator: 246 a.a.    .

>REG0195 NC_010465:1837676-1838413 [Yersinia pseudotuberculosis YPIII]
MIINFFDNESINEDIKNYIQRRIKAYGNIRYSYLLMNKKVPLHPAIISNYPLDWVKKYKKNSYHLIDPVILTAKGKVAPF
AWDDNSVINIKSTDSAVFNLAREYNIVNGYTFVLHDNNNNMATLNVSSGDDDSIFFDESIEVNKEKIQMLLIFIHDKMLG
LYNKSHHENNTLNKKENKREIFSPRENEILYWASVGKTYSEIAIILGIKKSTVKFHIGNIVRKLGVLNAKHAIRLGIELQ
LIKPI*

  Nucleotide sequence of regulator: 738 bp    .

>REG0195 NC_010465:1837676-1838413 [Yersinia pseudotuberculosis YPIII]
ATGATAATTAATTTTTTTGATAATGAAAGCATTAATGAAGATATAAAAAATTATATCCAACGGAGGATAAAAGCCTATGG
CAATATCCGCTATTCTTATTTGCTAATGAATAAAAAAGTACCGCTACATCCGGCGATCATATCGAACTACCCACTAGACT
GGGTAAAAAAGTACAAGAAGAATAGTTATCACCTGATCGACCCTGTGATTTTGACCGCCAAAGGCAAAGTCGCACCATTT
GCATGGGATGACAATTCAGTCATCAATATAAAATCAACTGATTCGGCCGTGTTCAATCTCGCCAGAGAATATAATATTGT
TAATGGTTATACCTTCGTTCTTCATGATAATAACAATAATATGGCGACCTTGAATGTTTCAAGTGGCGATGATGATAGTA
TTTTTTTCGATGAAAGCATCGAGGTGAACAAAGAAAAAATACAAATGTTACTTATTTTTATTCACGATAAAATGCTTGGT
CTATATAATAAAAGTCATCATGAAAACAACACGTTGAATAAAAAAGAGAATAAAAGAGAAATTTTCTCTCCTCGGGAAAA
TGAAATTCTGTACTGGGCCAGTGTAGGAAAGACTTACTCTGAAATTGCGATAATTTTAGGTATTAAGAAAAGCACAGTGA
AATTTCATATTGGTAATATTGTTAGGAAGTTAGGTGTTCTCAATGCCAAACATGCAATAAGACTTGGCATTGAGTTACAA
TTGATCAAACCTATTTAG