Detailed information of regulator


Summary

Regulator ID REG0191 experimental
Regulator type protein
Regulatory pathway (from literatures) (p)ppGpp regulatory pathway
KEGG pathway (determined by BlastKOALA) Metabolic pathways (map01100); Microbial metabolism in diverse environments (map01120); Carbon metabolism (map01200); Pyruvate metabolism (map00620); Propanoate metabolism (map00640); Carbon fixation pathways in prokaryotes (map00720); Methane metabolism (map00680); Taurine and hypotaurine metabolism (map00430)
Related T6SS T6SS00260 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (401 a.a.); Nucleotide sequence (1203 bp)
Description RovM upregulates T6SS4 by binding directly to the T6SS4 promoter, even also suppressing the expression of RovA.
Reference

External database links

Locus tag (Gene) YPK_1551 (RovM)
Coordinates (Strand) 1713682..1714884 (-)
NCBI ID 499506038
RefSeq NC_010465
Uniprot ID ACKA_YERPS, ACKA_YERPY
KEGG ID ypo:BZ17_4042, yps:YPTB2597, ypy:YPK_1551
KEGG pathway (determined by BlastKOALA) map01100; map01120; map01200; map00620; map00640; map00720; map00680; map00430
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
T6SS-4 promoter region TGCTAATGGTTATGTAAATTTAATAAATGTA

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Acetate_kinase PF00871.19 2e-184 5..393

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-400 MSSKLVLVLNCGSSSLKFAIIDATNGEEHISGLAECFHLPEARIKWKVDGGKQEAALGAGAAHSEALNFIVNTILAQKPALSAQLTAIGHRIVHGGEKFTSSVIVTDDVIQGIKDSIPFAPLHNPAHLIGIAEALKSFPNLADKNVAVFDTAFHQTMPEESYLYALPYSLYKDHGIRRYGAHGTSHFYVSQEAAKILNKPLEELNVITCHLGNGGSVTAVRNGKCVDTSMGLTPLEGLVMGTRSGDLDPAIIFHLHDAMGMSVDQINTLLTKESGLLGLTEVTSDCRYVEDNYATKADAKRAMDVFCHRLAKYIGSYTALMDGRLDAVVFTGGIGENAAMVRELTLDKLGLLGFEIDHERNMAARFGKSGTITKDSSRLALVIPTNEELVIAQDAARLTA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8038 - -



  Protein sequence of regulator: 401 a.a.    .

>REG0191 NC_010465:c1714884-1713682 [Yersinia pseudotuberculosis YPIII]
MSSKLVLVLNCGSSSLKFAIIDATNGEEHISGLAECFHLPEARIKWKVDGGKQEAALGAGAAHSEALNFIVNTILAQKPA
LSAQLTAIGHRIVHGGEKFTSSVIVTDDVIQGIKDSIPFAPLHNPAHLIGIAEALKSFPNLADKNVAVFDTAFHQTMPEE
SYLYALPYSLYKDHGIRRYGAHGTSHFYVSQEAAKILNKPLEELNVITCHLGNGGSVTAVRNGKCVDTSMGLTPLEGLVM
GTRSGDLDPAIIFHLHDAMGMSVDQINTLLTKESGLLGLTEVTSDCRYVEDNYATKADAKRAMDVFCHRLAKYIGSYTAL
MDGRLDAVVFTGGIGENAAMVRELTLDKLGLLGFEIDHERNMAARFGKSGTITKDSSRLALVIPTNEELVIAQDAARLTA
*

  Nucleotide sequence of regulator: 1203 bp    .

>REG0191 NC_010465:c1714884-1713682 [Yersinia pseudotuberculosis YPIII]
ATGTCGAGTAAGCTAGTACTGGTTCTTAACTGCGGTAGCTCCTCCCTGAAATTTGCAATCATCGATGCGACCAACGGTGA
AGAGCATATTTCTGGTTTAGCCGAATGTTTCCATCTGCCAGAAGCCCGTATCAAATGGAAAGTTGACGGCGGTAAGCAGG
AAGCAGCATTGGGTGCTGGTGCAGCACACAGCGAAGCACTGAATTTTATTGTTAATACTATTTTGGCACAAAAACCAGCG
CTTTCTGCTCAGTTGACGGCCATCGGTCACCGTATCGTTCACGGCGGCGAGAAATTCACTTCGTCAGTTATCGTTACCGA
CGATGTTATTCAGGGTATCAAAGATTCTATCCCGTTTGCACCACTACACAACCCTGCCCACTTGATCGGTATTGCTGAAG
CCTTGAAATCCTTCCCTAATCTGGCGGATAAAAATGTGGCCGTCTTTGACACCGCGTTCCATCAGACCATGCCGGAAGAG
TCTTATCTCTATGCTCTGCCGTACAGCCTGTATAAAGATCACGGTATCCGCCGCTATGGCGCACACGGTACCAGCCACTT
CTATGTTAGCCAAGAAGCCGCCAAGATCTTGAACAAGCCGTTGGAAGAACTGAACGTGATTACCTGCCATTTGGGCAACG
GTGGTTCAGTAACCGCAGTGCGTAACGGTAAATGTGTCGATACGTCAATGGGGCTAACGCCACTGGAAGGTCTGGTGATG
GGGACCCGCAGTGGTGATCTCGATCCCGCTATTATCTTCCATCTGCATGATGCTATGGGCATGAGCGTTGATCAAATCAA
CACGTTGCTGACCAAAGAGTCAGGCCTGTTGGGGCTGACTGAAGTCACCAGCGACTGCCGTTATGTTGAAGATAACTACG
CCACCAAAGCTGACGCGAAACGTGCGATGGATGTGTTCTGTCACCGTTTGGCAAAATATATCGGTTCCTATACCGCGCTG
ATGGATGGTCGTCTGGATGCGGTCGTCTTCACCGGTGGTATTGGTGAAAATGCTGCCATGGTCCGTGAACTGACGCTGGA
CAAATTGGGCCTGCTGGGCTTTGAGATTGACCACGAACGTAACATGGCAGCACGCTTTGGCAAGTCAGGTACCATCACCA
AAGATAGCAGCCGTCTGGCTCTGGTTATCCCAACCAACGAAGAGTTGGTTATCGCGCAAGACGCAGCCCGTCTGACTGCG
TAA