Detailed information of regulator


Summary

Regulator ID REG0189 experimental
Regulator type protein
Regulatory pathway (from literatures) Global regulator
KEGG pathway (determined by BlastKOALA) Biofilm formation - Escherichia coli (map02026)
Related T6SS T6SS00260 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (306 a.a.); Nucleotide sequence (918 bp)
Description OxyR specifically recognizes an operator within the T6SS-4 promoter, and specifically activates the expression of T6SS-4.
Reference

External database links

Locus tag (Gene) YPK_4079 (OxyR)
Coordinates (Strand) 4502978..4503895 (-)
NCBI ID 488138270
RefSeq NC_010465
Uniprot ID A0A0E8XSU3_9GAMM, A0A0U1R2I3_YERP3, A0A0E1P2E1_YERPA, A0A0T9R9U7_9GAMM, A0A0H2YEU5_YERPN, A0A0H3B705_YERPY, A0A0T9JIP2_YERPU
KEGG ID ypi:YpsIP31758_0138, ypy:YPK_4079, ypa:YPA_0107, ypn:YPN_0052, ypc:BZ23_3739
KEGG pathway (determined by BlastKOALA) map02026
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
T6SS-4 promoter region TGTATTATCGATATTGGATAGTGTTGTCTCTTATCGATATTGGATATTGTCCATACATTT

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
LysR_substrate PF03466.22 4.6e-52 88..293
HTH_1 PF00126.29 6.9e-19 3..61

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-305 MNIRDLEYLVALAEFRHFRRAADSCHVSQPTLSGQIRKLEDELGIMLLERTSRKVLFTQAGLLLVEQAKTVLREVKVLKEMASLQGESMSGPLHIGLIPTVGPYLLPQIIPMLHKTFPKLEMYLHEAQTQNLLAQLDSGKLDCAILALVKETEAFIEIPLFDEPMNLAIYADHPWANRERVEMHELAGEKLLMLEDGHCLRDQAMGFCFQAGADEDTHFRATSLETLRNMVAAGSGITLLPALAVPNERQRDGVCYLECYKPVPKRTIALVYRPGSPLRGRYEQLAEAIRDHMQERMAPSLEQAI



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9785 - -



  Protein sequence of regulator: 306 a.a.    .

>REG0189 NC_010465:c4503895-4502978 [Yersinia pseudotuberculosis YPIII]
MNIRDLEYLVALAEFRHFRRAADSCHVSQPTLSGQIRKLEDELGIMLLERTSRKVLFTQAGLLLVEQAKTVLREVKVLKE
MASLQGESMSGPLHIGLIPTVGPYLLPQIIPMLHKTFPKLEMYLHEAQTQNLLAQLDSGKLDCAILALVKETEAFIEIPL
FDEPMNLAIYADHPWANRERVEMHELAGEKLLMLEDGHCLRDQAMGFCFQAGADEDTHFRATSLETLRNMVAAGSGITLL
PALAVPNERQRDGVCYLECYKPVPKRTIALVYRPGSPLRGRYEQLAEAIRDHMQERMAPSLEQAI*

  Nucleotide sequence of regulator: 918 bp    .

>REG0189 NC_010465:c4503895-4502978 [Yersinia pseudotuberculosis YPIII]
ATGAATATTCGTGATCTAGAGTACTTAGTGGCGTTGGCTGAATTTAGGCACTTCCGGCGTGCCGCCGACTCCTGTCATGT
CAGCCAACCCACATTAAGCGGTCAGATTCGTAAACTGGAAGATGAGTTGGGGATCATGTTGTTGGAGCGAACTAGTCGTA
AGGTGTTGTTTACACAGGCTGGTTTACTGTTGGTGGAGCAGGCGAAAACGGTATTACGGGAAGTGAAAGTACTGAAAGAG
ATGGCCAGTTTACAGGGTGAAAGTATGTCTGGGCCGTTGCATATTGGGCTTATTCCTACCGTTGGGCCTTATCTGTTACC
ACAAATTATTCCTATGCTGCATAAAACATTCCCCAAATTGGAAATGTATCTGCATGAAGCCCAGACCCAAAATCTCTTAG
CCCAGTTGGATAGTGGTAAATTGGATTGTGCCATTTTAGCCCTGGTCAAAGAGACCGAAGCTTTTATCGAAATTCCGTTA
TTTGACGAGCCGATGAATCTAGCCATTTATGCCGATCATCCGTGGGCGAACCGCGAAAGAGTGGAGATGCATGAATTGGC
GGGAGAGAAGTTACTGATGCTGGAAGATGGTCATTGTTTACGTGATCAGGCGATGGGCTTTTGCTTCCAGGCTGGAGCGG
ATGAAGATACTCACTTCCGGGCGACTAGCTTGGAAACCCTGCGCAACATGGTCGCAGCGGGTAGTGGTATTACGCTGTTG
CCAGCACTGGCTGTGCCGAATGAAAGACAGCGCGATGGTGTATGTTATCTGGAGTGCTACAAACCTGTCCCTAAACGCAC
CATTGCGTTGGTGTATCGCCCCGGTTCTCCATTGCGTGGCCGCTATGAACAACTTGCCGAGGCAATACGTGATCACATGC
AAGAGCGCATGGCCCCATCATTAGAACAGGCGATTTAA