Detailed information of regulator


Summary

Regulator ID REG0187 experimental
Regulator type protein
Regulatory pathway (from literatures) (p)ppGpp regulatory pathway
KEGG pathway (determined by BlastKOALA) Metabolic pathways (map01100); Purine metabolism (map00230)
Related T6SS T6SS00260 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (745 a.a.); Nucleotide sequence (2235 bp)
Description The (p)ppGpp synthase RelA functions upstream of RovM and RovA to regulate T6SS4 expression.
Reference

External database links

Locus tag (Gene) YPK_3449 (RelA)
Coordinates (Strand) 3783755..3785989 (-)
NCBI ID 488138165
RefSeq NC_010465
Uniprot ID A0A0E8XEX7_9GAMM, Q66EE2_YERPS, A0A0U1QZQ2_YERP3, A0A0E1NR11_YERPA, A0A0H2YEL7_YERPN, A0A0H3B7D7_YERPY
KEGG ID ypo:BZ17_1804, ypa:YPA_2877, ypi:YpsIP31758_3319, yps:YPTB0751, ypn:YPN_0713, ypy:YPK_3449
KEGG pathway (determined by BlastKOALA) map01100; map00230
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
YPK_1551 (RovM) 499506038
YPK_1876 (RovA) 488139747

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
HD_4 PF13328.8 2.2e-41 46..191
RelA_SpoT PF04607.19 2.6e-36 251..360
TGS PF02824.23 4e-21 405..464
ACT_4 PF13291.8 8.5e-17 664..740
DUF5913 PF19296.1 1.5e-12 483..647

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-744 MVAVRSAHLNPAGEFALDDWIASLGLANPQSSERLAETWRYCEQQTQNHPDASLLLWRGLEMVEILSTLSMDNDSMRAALLFPLVDANIVDETTLTEQFGKGITYLVHGVRDMDAIRQLKATHNDSMSSEQVDNVRRMLLAMVEDFRCVVIKLAERIAHLREVKDAPEDERVLAAKECSNIYAPLANRLGIGQIKWELEDFCFRYLHPDEYKKIAKLLHERRIDREQFIDDFVASLHKAMADEGIKADIYGRPKHIYSIWRKMQKKSLAFDELFDVRAVRVVVERLQDCYAALGIVHTHFRHLPDEFDDYVANPKPNGYQSIHTVVLGPRGKTLEIQIRTRQMHEDAELGVAAHWKYKEGAVAAGRSSYEGRIAWLRKLIAWQEEMADSGEMLDEVRSQVFDDRVYVFTPKGDVIDLPAGSTPLDFAYHIHSDVGHRCIGAKISGRIVPFTYQLQMGDQIEIITQKQPNPSRDWLNPNLGYITTSRGRSKIHNWFRKQDRDKNILAGRQMLDDELEHLDISLKEAEKLLVPRYNMNSMDEVLAAIGGGDIRLNQMVNFLQGKLNKPTAEEADLEALRHLNNKHQPAPRNASKDSGRIVVEGVGNLMHHIARCCQPIPGDQIIGFITQGRGISIHRADCEQLAELESHAPERIVDAVWGESYSSGYSLVVRVTANDRSGLLRDITTILANEKVNVLGVASRSDTKKMVATIDMDIEIYNLQVLGRVLAKLNQLPDVIDARRLHGN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9842 - -



  Protein sequence of regulator: 745 a.a.    .

>REG0187 NC_010465:c3785989-3783755 [Yersinia pseudotuberculosis YPIII]
MVAVRSAHLNPAGEFALDDWIASLGLANPQSSERLAETWRYCEQQTQNHPDASLLLWRGLEMVEILSTLSMDNDSMRAAL
LFPLVDANIVDETTLTEQFGKGITYLVHGVRDMDAIRQLKATHNDSMSSEQVDNVRRMLLAMVEDFRCVVIKLAERIAHL
REVKDAPEDERVLAAKECSNIYAPLANRLGIGQIKWELEDFCFRYLHPDEYKKIAKLLHERRIDREQFIDDFVASLHKAM
ADEGIKADIYGRPKHIYSIWRKMQKKSLAFDELFDVRAVRVVVERLQDCYAALGIVHTHFRHLPDEFDDYVANPKPNGYQ
SIHTVVLGPRGKTLEIQIRTRQMHEDAELGVAAHWKYKEGAVAAGRSSYEGRIAWLRKLIAWQEEMADSGEMLDEVRSQV
FDDRVYVFTPKGDVIDLPAGSTPLDFAYHIHSDVGHRCIGAKISGRIVPFTYQLQMGDQIEIITQKQPNPSRDWLNPNLG
YITTSRGRSKIHNWFRKQDRDKNILAGRQMLDDELEHLDISLKEAEKLLVPRYNMNSMDEVLAAIGGGDIRLNQMVNFLQ
GKLNKPTAEEADLEALRHLNNKHQPAPRNASKDSGRIVVEGVGNLMHHIARCCQPIPGDQIIGFITQGRGISIHRADCEQ
LAELESHAPERIVDAVWGESYSSGYSLVVRVTANDRSGLLRDITTILANEKVNVLGVASRSDTKKMVATIDMDIEIYNLQ
VLGRVLAKLNQLPDVIDARRLHGN*

  Nucleotide sequence of regulator: 2235 bp    .

>REG0187 NC_010465:c3785989-3783755 [Yersinia pseudotuberculosis YPIII]
ATGGTTGCGGTACGAAGTGCGCATTTAAACCCAGCGGGTGAGTTTGCTCTTGACGATTGGATTGCCAGTTTAGGGCTTGC
CAATCCGCAGTCATCTGAGCGATTAGCCGAAACCTGGCGTTACTGTGAACAACAGACGCAAAACCATCCCGATGCCTCGT
TATTACTGTGGCGCGGTCTTGAAATGGTTGAAATTCTTTCCACTCTGAGTATGGATAACGACAGTATGCGCGCGGCGCTG
CTGTTCCCGCTGGTAGACGCCAATATCGTGGACGAAACTACCCTGACCGAGCAATTCGGTAAGGGGATTACGTATCTGGT
ACACGGTGTGCGTGATATGGATGCTATCCGCCAGTTAAAAGCCACTCACAACGATTCCATGAGCTCGGAGCAAGTGGATA
ACGTGCGCCGTATGTTATTGGCGATGGTGGAGGATTTCCGCTGCGTGGTGATCAAGCTGGCAGAGCGGATCGCTCATCTG
CGTGAAGTCAAAGATGCACCGGAAGATGAACGTGTTCTGGCGGCTAAAGAGTGTTCCAATATTTACGCACCACTGGCGAA
CCGTTTGGGGATTGGTCAGATTAAATGGGAGTTGGAGGATTTCTGCTTCCGTTATCTGCATCCAGATGAATATAAGAAAA
TCGCCAAATTACTCCACGAGAGGCGTATTGATCGCGAACAATTTATTGATGACTTCGTTGCTTCATTACATAAGGCGATG
GCTGACGAAGGCATTAAAGCCGACATTTATGGCCGACCGAAGCATATCTACAGCATTTGGCGCAAAATGCAGAAAAAGTC
GCTGGCCTTCGATGAGCTATTCGACGTCCGCGCGGTGCGGGTGGTGGTGGAACGCTTGCAGGATTGTTATGCCGCGTTAG
GGATTGTTCACACGCACTTCCGGCATTTACCTGATGAATTTGATGATTATGTGGCCAACCCTAAGCCAAATGGTTACCAA
TCGATCCATACCGTGGTGCTTGGGCCACGAGGTAAAACGTTAGAGATTCAGATCCGTACCCGCCAGATGCATGAAGATGC
CGAGTTGGGGGTTGCTGCGCACTGGAAATATAAAGAAGGGGCCGTGGCAGCGGGCCGTTCGAGTTATGAAGGGCGAATTG
CCTGGTTACGTAAATTGATCGCCTGGCAGGAAGAGATGGCTGATTCTGGCGAAATGCTGGATGAAGTGCGCAGCCAGGTA
TTTGATGATCGGGTGTACGTGTTTACACCGAAAGGCGATGTGATTGACCTACCTGCCGGCTCGACGCCGCTGGATTTTGC
CTACCATATTCATAGCGATGTGGGCCACCGTTGTATCGGTGCCAAAATCAGTGGCCGCATTGTGCCGTTTACTTATCAGT
TGCAGATGGGTGATCAAATTGAAATTATCACTCAAAAACAGCCAAACCCAAGCCGTGACTGGCTGAATCCTAACCTCGGT
TACATCACGACCAGTCGCGGACGTTCCAAAATTCATAACTGGTTCCGCAAACAAGATAGAGATAAGAATATTCTGGCTGG
CCGGCAAATGCTGGATGATGAGCTGGAGCATCTGGATATCAGTCTGAAAGAGGCTGAGAAGCTGCTTGTTCCGCGTTACA
ACATGAATTCGATGGATGAAGTGTTAGCGGCGATTGGGGGGGGTGATATCCGTCTGAATCAGATGGTGAACTTCCTCCAG
GGCAAACTGAATAAACCAACGGCAGAAGAGGCTGATTTAGAAGCACTCCGTCATCTGAATAACAAGCATCAGCCCGCGCC
ACGTAACGCCAGCAAAGACAGTGGGCGTATTGTGGTCGAAGGTGTCGGTAACCTGATGCACCATATTGCCCGTTGTTGCC
AGCCGATCCCCGGTGATCAAATTATCGGTTTTATCACGCAAGGGCGGGGGATATCGATTCACCGTGCAGATTGTGAGCAG
TTGGCTGAATTGGAATCCCATGCACCGGAACGGATTGTCGATGCAGTCTGGGGCGAAAGCTACTCCAGCGGTTATTCGCT
GGTGGTGCGGGTTACGGCTAATGACCGCAGTGGGTTATTGCGCGATATCACTACGATCCTGGCAAATGAGAAAGTTAACG
TACTGGGCGTTGCCAGCCGCAGCGATACCAAAAAGATGGTGGCGACTATCGATATGGATATCGAGATCTATAACTTGCAG
GTGCTGGGCCGGGTATTGGCCAAACTGAATCAGTTGCCGGATGTCATAGACGCCCGTCGCCTCCATGGCAATTAG