Detailed information of regulator


Summary

Regulator ID REG0185 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS-RR
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Biofilm formation - Escherichia coli (map02026)
Related T6SS T6SS00225 experimental (Type i3)
Strain Yersinia pseudotuberculosis IP 31758
Replicon chromosome
Sequence Protein sequence (240 a.a.); Nucleotide sequence (720 bp)
Description EMSA and β-galactosidase activity assay showed OmpR binds to the T6SS-4 promoter region and activates transcription of the Y. Pseudotuberculosis T6SS-4
Reference

External database links

Locus tag (Gene) YpsIP31758_3980 (ompR)
Coordinates (Strand) 4465260..4465979 (-)
NCBI ID 490527984
RefSeq NC_009708
Uniprot ID A0A0T9PI75_9GAMM, A0A0E8XQQ1_9GAMM, A0A0T9PCN7_YERKR, A0A085U722_YERRU, A0A0U1QUP4_YERP3, A0A0T9PCQ9_9GAMM, A0A0T9JIU2_YERPU, A0A2G4U1D2_YERBE
KEGG ID ypi:YpsIP31758_3980, ykr:CH54_2320, yrb:UGYR_10995, yru:BD65_2143, ysi:BF17_06670
KEGG pathway (determined by BlastKOALA) map02020; map02026
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
T6SS-4 promoter CATATCTATGTCCTCTTATTTTGGCTATTCATCCACGTCATCGTGCTAATGGTTATGTAAATTTAATAAATGTATGAAGGGTGAAAAAATCTGCGAATAAGTTTATCCCTACTACTGTTTTTTGTCCTA Putative OmpR binding sites identified by in silico analyses using Virtual Footprint is indicated by red

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Response_reg PF00072.26 1.5e-29 7..117
Trans_reg_C PF00486.30 2.4e-22 157..232

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-239 MQENHKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPGEDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVLRRQANELPGAPSQEEAIIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGSKA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9985 - -



  Protein sequence of regulator: 240 a.a.    .

>REG0185 NC_009708:c4465979-4465260 [Yersinia pseudotuberculosis IP 31758]
MQENHKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPGEDGLSICRRLRSQSNPMPII
MVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVLRRQANELPGAPSQEEAIIAFGKFKLNLGTREMFREDEPMP
LTSGEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGSKA*

  Nucleotide sequence of regulator: 720 bp    .

>REG0185 NC_009708:c4465979-4465260 [Yersinia pseudotuberculosis IP 31758]
ATGCAAGAGAATCACAAGATTCTGGTCGTTGATGACGATATGCGTCTACGTGCGCTACTAGAACGTTATTTGACGGAGCA
AGGTTTTCAGGTCCGCAGTGTGGCTAATGCTGAACAGATGGATCGCTTGCTGACTCGTGAGTCCTTCCACCTGATGGTAC
TTGACCTGATGTTACCGGGCGAAGATGGTTTGTCGATTTGCCGCCGCCTGCGTAGTCAAAGTAATCCGATGCCAATCATT
ATGGTGACGGCAAAAGGCGAAGAAGTGGACCGTATCGTTGGGCTGGAAATCGGTGCGGATGATTATATTCCCAAGCCATT
CAACCCTCGCGAATTACTGGCTCGTATCCGTGCGGTACTGCGCCGTCAGGCAAACGAACTGCCGGGAGCGCCTTCACAAG
AAGAGGCGATCATTGCGTTTGGCAAATTCAAACTGAATCTGGGCACGCGCGAGATGTTTCGTGAAGATGAGCCTATGCCA
CTGACTAGCGGTGAATTTGCGGTGCTTAAAGCCTTGGTTAGCCACCCACGTGAGCCGTTGTCCCGCGATAAGCTGATGAA
TCTGGCCCGTGGCCGTGAATACAGTGCGATGGAACGTTCTATTGATGTCCAGATTTCTCGTTTGCGTCGGATGGTGGAAG
AAGATCCGGCCCATCCGCGTTATATCCAGACAGTGTGGGGTCTAGGCTACGTCTTTGTGCCGGACGGCAGTAAAGCATGA