Detailed information of regulator


Summary

Regulator ID REG0182 experimental
Regulator type protein
Regulatory pathway (from literatures) Global regulator
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Biofilm formation - Vibrio cholerae (map05111); Flagellar assembly (map02040)
Related T6SS T6SS00208 insolico (Type i1)
Strain Vibrio cholerae O395
Replicon chromosome
Sequence Protein sequence (488 a.a.); Nucleotide sequence (1464 bp)
Description Plasmids constructed transcriptional fusions, in whichβ-glucuronidase, is under the control of the promoter of the T6SS have been introduced into the E. coli strain or its rpoN derivative, and β-glucuronidase activities showed T6SS promotor activites was reduced in absence of rpoN and EMSA assays results the promoter regions of these T6SS gene clusters are under the control of σ54.
Reference

External database links

Locus tag (Gene) VC0395_A2109 (rpoN)
Coordinates (Strand) 2265078..2266541 (+)
NCBI ID 446727517
RefSeq NC_009457
Uniprot ID Q9KP49_VIBCH, A0A0X1L3Q8_VIBCO, A0A0H3AJL7_VIBC3, D7HFG5_VIBCL, A0A0K9URM2_VIBCL, A0A0H3Q430_VIBCL, C3LRJ2_VIBCM, A0A086SNJ1_VIBCL
KEGG ID vch:VC_2529, vcm:VCM66_2450, vcq:EN18_15695, vcx:VAA049_365, vco:VC0395_A2109
KEGG pathway (determined by BlastKOALA) map02020; map05111; map02040
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
T6SS gene cluster promoter (PVCA0107/VC0395_RS00160) catattacgtctccaatacctatgccaaacgttgtcaatgaaacagttgattgaaatcattcaatcaaccaagaatcttgaacttatccttagtgataactaagggctctcatttcaaaatatgaaatagagtcaatcacttccgtgacactgtgagaaaataaatcccacactaagccatgtcacagagtgttgttgtattttgatatattgatgaaaaatgggcttattatgcaaacttatcattagcagctttttgctgccatgtatcagttatctggtataaatattgtttgcggtgatctaatacccaataaatatgagatggcattctattcatggagacaaaaaagtaatcgaaaaaaaacccgaagcgtgatcttttaccc Putative σ54 binding sequence is indicated by red color
hcp promoter (PVCA0017/VC0395_0116) aaagttggcatcccacttgct Putative σ54 binding sequence is indicated by red color

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Sigma54_DBD PF04552.15 5.8e-73 327..485
Sigma54_CBD PF04963.15 7.3e-59 128..315
Sigma54_AID PF00309.22 3.3e-17 4..49

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-487 MKPSLQLKLGQQLAMTPQLQQAIRLLQLSTLDLQQEIQEALESNPLLEVEENQDEAPSLDSVRMTEESPREPEELYEPEPQDSSDLIEKSEISAELEMDTTWDEVYSANTGSTGLALDDDAPIYQGETTQTLQDYLHWQLDLTPFSDVDRTIAVALIDAIDDYGYLTVSLEEIQESLRSDDIELDEIEAVRKRIQQFDPFGVASLNLQDCLLLQLTTYPCDTPWLEEARLLLSQYIDDLGNRDYKTILKETKLKEEDLREILQLIQQLDPRPGSRIAQDHAEYVIPDVSVYKEQGRWLVTINPDSVPKLKINQQYADLMRGNNAESNYIRTNLQEAKWLIKSLESRNETLLKVAKCIVEHQHDFFEYGEEAMKPMVLNDVAMAVEMHESTISRVTTQKYMHTPRGIFELKYFFSSHVSTDNGGECSSTAIRALIKKLVAAENPAKPLSDSKIATLLADQGIQVARRTIAKYRESLGIAPSSQRKRLL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9820 - -



  Protein sequence of regulator: 488 a.a.    .

>REG0182 NC_009457:2265078-2266541 [Vibrio cholerae O395]
MKPSLQLKLGQQLAMTPQLQQAIRLLQLSTLDLQQEIQEALESNPLLEVEENQDEAPSLDSVRMTEESPREPEELYEPEP
QDSSDLIEKSEISAELEMDTTWDEVYSANTGSTGLALDDDAPIYQGETTQTLQDYLHWQLDLTPFSDVDRTIAVALIDAI
DDYGYLTVSLEEIQESLRSDDIELDEIEAVRKRIQQFDPFGVASLNLQDCLLLQLTTYPCDTPWLEEARLLLSQYIDDLG
NRDYKTILKETKLKEEDLREILQLIQQLDPRPGSRIAQDHAEYVIPDVSVYKEQGRWLVTINPDSVPKLKINQQYADLMR
GNNAESNYIRTNLQEAKWLIKSLESRNETLLKVAKCIVEHQHDFFEYGEEAMKPMVLNDVAMAVEMHESTISRVTTQKYM
HTPRGIFELKYFFSSHVSTDNGGECSSTAIRALIKKLVAAENPAKPLSDSKIATLLADQGIQVARRTIAKYRESLGIAPS
SQRKRLL*

  Nucleotide sequence of regulator: 1464 bp    .

>REG0182 NC_009457:2265078-2266541 [Vibrio cholerae O395]
ATGAAACCGTCATTACAGCTCAAGCTAGGTCAACAGTTAGCCATGACTCCGCAGCTCCAGCAGGCGATTCGTCTGTTGCA
GCTTTCGACGCTGGATCTGCAGCAAGAAATTCAGGAAGCATTGGAATCTAACCCCTTGTTAGAGGTGGAAGAGAACCAAG
ACGAAGCGCCATCGCTTGATAGCGTACGTATGACGGAAGAAAGCCCGCGCGAGCCAGAAGAACTCTACGAACCTGAACCG
CAGGATAGCTCGGATCTGATTGAAAAATCGGAAATCAGCGCTGAATTAGAGATGGATACCACTTGGGATGAAGTCTACAG
CGCCAATACTGGCAGTACAGGACTGGCACTCGATGATGATGCCCCTATCTACCAAGGCGAAACCACCCAAACCCTGCAAG
ATTATCTTCACTGGCAACTCGACTTAACTCCCTTTAGCGATGTGGATCGCACCATTGCCGTTGCACTTATCGATGCTATC
GACGATTACGGTTATTTAACCGTCTCACTAGAGGAGATCCAAGAGAGCCTGCGCAGTGATGACATTGAGTTGGATGAGAT
TGAAGCGGTACGTAAACGCATTCAGCAGTTTGACCCCTTTGGTGTGGCATCGCTTAATCTGCAAGACTGCTTGTTGCTGC
AACTCACCACCTATCCCTGTGATACTCCTTGGCTGGAAGAAGCGCGTTTACTGCTCTCACAGTACATCGATGATTTAGGG
AATCGCGATTACAAAACCATTCTGAAAGAGACTAAGCTCAAAGAAGAGGACTTGCGCGAGATCCTGCAACTCATCCAACA
GCTCGATCCTCGCCCCGGCAGTCGAATTGCCCAAGATCACGCTGAATACGTTATACCTGACGTGTCAGTCTATAAAGAAC
AAGGTCGATGGCTGGTCACCATCAACCCAGATAGTGTGCCTAAACTGAAGATCAATCAGCAGTATGCCGACCTGATGCGC
GGTAATAATGCGGAGAGCAACTACATCCGTACCAATTTGCAAGAGGCAAAATGGCTGATCAAAAGTTTAGAAAGTAGAAA
CGAGACACTGCTCAAAGTTGCCAAGTGCATAGTTGAACACCAACACGATTTCTTCGAGTATGGAGAAGAGGCGATGAAGC
CGATGGTGCTCAACGATGTGGCGATGGCGGTGGAAATGCATGAATCGACAATTTCGCGTGTCACCACGCAGAAATACATG
CATACCCCGCGCGGCATTTTTGAGTTGAAGTACTTTTTCTCCAGCCACGTCAGTACTGACAATGGCGGAGAGTGCTCGTC
CACTGCGATCAGGGCGCTGATCAAAAAACTGGTGGCGGCAGAGAATCCTGCCAAACCACTCAGTGACAGCAAGATCGCAA
CCCTACTCGCTGACCAAGGCATCCAAGTCGCGCGGCGAACCATCGCCAAATATCGTGAATCACTTGGCATCGCCCCATCA
AGTCAGCGCAAACGCCTGCTATAG