Detailed information of regulator


Summary

Regulator ID REG0178 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS regulatory pathway
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00158 experimental (Type ii)
Strain Francisella tularensis subsp. novicida U112
Replicon chromosome
Sequence Protein sequence (112 a.a.); Nucleotide sequence (336 bp)
Description MglA positively regulates the expression of fevR and, MglA and FevR are both required to initiate transcription of the genes in the MglA/SspA regulon including T6SS operon.
Reference

External database links

Locus tag (Gene) FTN_0480 (fevR/PigR)
Coordinates (Strand) 486541..486876 (+)
NCBI ID 489108070
RefSeq NC_008601
Uniprot ID A0A153JBB2_9GAMM, A0A0B3VR08_FRATU, A0A1J0KLY4_FRANO, A0Q561_FRATN, A0A1S2WUJ7_9GAMM, F4BJE8_9GAMM
KEGG ID ftn:FTN_0480, fhi:FSC454_02210, ftc:DA46_245, ftx:AW25_1548, fcn:FN3523_0435, ftv:CH67_751, ftz:CH68_485
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
T6SS Transciption -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-111 MANQYSGNFEQIVKNRFKCSAREILLKCQREGLSYQDAEKVLGFKHVTIRKWAKRFDIKLPPRFRSHDEHLEQKREIAYVNQCKLNKINKRNVFSRCWINMNLYSVIKAKS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9967 - -



  Protein sequence of regulator: 112 a.a.    .

>REG0178 NC_008601:486541-486876 [Francisella tularensis subsp. novicida U112]
MANQYSGNFEQIVKNRFKCSAREILLKCQREGLSYQDAEKVLGFKHVTIRKWAKRFDIKLPPRFRSHDEHLEQKREIAYV
NQCKLNKINKRNVFSRCWINMNLYSVIKAKS*

  Nucleotide sequence of regulator: 336 bp    .

>REG0178 NC_008601:486541-486876 [Francisella tularensis subsp. novicida U112]
ATGGCGAATCAATATTCTGGAAATTTTGAGCAAATTGTCAAAAATAGATTTAAATGCTCAGCAAGAGAGATCTTATTAAA
ATGCCAAAGAGAAGGCTTAAGTTACCAAGATGCTGAAAAAGTTTTGGGTTTTAAGCATGTTACTATCAGAAAGTGGGCTA
AGAGATTTGATATTAAGCTCCCGCCTAGATTTAGATCTCATGATGAGCATCTTGAACAAAAAAGAGAGATAGCATATGTC
AATCAATGTAAGTTGAATAAAATCAATAAAAGAAATGTTTTTAGTCGCTGCTGGATAAATATGAATCTTTATTCTGTAAT
CAAAGCTAAATCTTGA