Detailed information of regulator


Summary

Regulator ID REG0177 experimental
Regulator type protein
Regulatory pathway (from literatures) Global regulator; TCS regulatory pathway
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00158 experimental (Type ii)
Strain Francisella tularensis subsp. novicida U112
Replicon chromosome
Sequence Protein sequence (136 a.a.); Nucleotide sequence (408 bp)
Description Western immunoblot analysis of IglA in an mglA mutant and an mglB background revealed that IglA is not expressed at detectable levels in these strains.; MglA postively regulates T6SS in transcriptional level.
Reference

External database links

Locus tag (Gene) FTN_RS06615 (mglB)
Coordinates (Strand) 1362901..1363308 (+)
NCBI ID 489112095
RefSeq NC_008601
Uniprot ID Q5NFG0_FRATT, A0A0E2ZLI6_FRATU, O52735_FRANO, A0Q7F7_FRATN, A0A1S2WX07_9GAMM
KEGG ID ftn:FTN_1291, ftx:AW25_714, ftu:FTT_1276
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
IglA expression -
T6SS Transciption -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
SspB PF04386.15 3.3e-19 4..100

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-135 MAMLRAYVVKATYNWLVDHGFTPYVLVDTEYEGVIVPANYIDEDKKILLDLSPQAIQDLVIDDNHISFAATFDSEPMSINIPIEAVLEVFSKETEQGMYAREFGYGININEGEDDETANPKKLGETNSDNVLSLD



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9948 - -



  Protein sequence of regulator: 136 a.a.    .

>REG0177 NC_008601:1362901-1363308 [Francisella tularensis subsp. novicida U112]
MAMLRAYVVKATYNWLVDHGFTPYVLVDTEYEGVIVPANYIDEDKKILLDLSPQAIQDLVIDDNHISFAATFDSEPMSIN
IPIEAVLEVFSKETEQGMYAREFGYGININEGEDDETANPKKLGETNSDNVLSLD*

  Nucleotide sequence of regulator: 408 bp    .

>REG0177 NC_008601:1362901-1363308 [Francisella tularensis subsp. novicida U112]
ATGGCTATGCTTAGAGCATATGTAGTTAAAGCTACATACAACTGGCTAGTTGATCATGGATTTACACCTTATGTTTTAGT
TGATACTGAGTATGAAGGTGTTATAGTACCAGCAAACTATATTGATGAAGATAAAAAAATACTTTTAGATTTATCTCCTC
AAGCAATACAAGATTTAGTTATAGATGATAATCATATTAGCTTTGCTGCAACGTTTGATAGTGAGCCAATGTCTATAAAT
ATTCCTATCGAGGCTGTCTTAGAAGTATTTTCTAAAGAAACAGAGCAAGGAATGTATGCTCGCGAATTTGGTTATGGAAT
TAATATCAATGAAGGCGAAGATGATGAAACTGCTAATCCTAAGAAATTAGGAGAAACTAATTCAGATAACGTTCTTTCAT
TAGATTAA