Detailed information of regulator


Summary

Regulator ID REG0176 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS-RR; TCS regulatory pathway
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Quorum sensing (map02024)
Related T6SS T6SS00158 experimental (Type ii)
Strain Francisella tularensis subsp. novicida U112
Replicon chromosome
Sequence Protein sequence (229 a.a.); Nucleotide sequence (687 bp)
Description Mobility shift assays were used and results His-PmrA can bind to the promotor of pmrA and pdpD.; Western immunoblot analysis of IglA in an mglA mutant and an mglB background revealed that IglA is not expressed at detectable levels in these strains and analogy with Escherichia coli homologue, SspA.
Reference

External database links

Locus tag (Gene) FTN_1465 (pmrA)
Coordinates (Strand) 1553358..1554044 (-)
NCBI ID 489108239
RefSeq NC_008601
Uniprot ID Q5NER1_FRATT, A0A0E2ZK20_FRATU, A0A1J0KQ81_FRANO, A0Q7W8_FRATN
KEGG ID ftx:AW25_536, ftn:FTN_1465, ftu:FTT_1557c
KEGG pathway (determined by BlastKOALA) map02020; map02024
PDB ID 5UIC

  Target
Target Regulation (↓/↑) Target sequence
FTN_1465 (pmrA) promotor -
pdpD promotor -
IglA expression -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Response_reg PF00072.26 2e-25 3..113
Trans_reg_C PF00486.30 1.5e-22 152..220

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-228 MRILLAEDDLHLGEGLLEALQKEGLIVNLVSDGEAAQTFIESGLYDIVVLDIGMPIKTGLEVLRNIRNRGIKVPIILLTARDGLEDRIKGLDLGADDYLTKPFELKELVARIKAISRRIDTRSGKSVNEEIRFGDYSFNPSSETVTKDGVIIPVSKKELALLAILVQNAGRVVPKTQLLEEVYSTDKEMDTNTLEVHMHNLRKKINIPNFIQTIRGVGYFVQKDKVIK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9977 - -



  Protein sequence of regulator: 229 a.a.    .

>REG0176 NC_008601:c1554044-1553358 [Francisella tularensis subsp. novicida U112]
MRILLAEDDLHLGEGLLEALQKEGLIVNLVSDGEAAQTFIESGLYDIVVLDIGMPIKTGLEVLRNIRNRGIKVPIILLTA
RDGLEDRIKGLDLGADDYLTKPFELKELVARIKAISRRIDTRSGKSVNEEIRFGDYSFNPSSETVTKDGVIIPVSKKELA
LLAILVQNAGRVVPKTQLLEEVYSTDKEMDTNTLEVHMHNLRKKINIPNFIQTIRGVGYFVQKDKVIK*

  Nucleotide sequence of regulator: 687 bp    .

>REG0176 NC_008601:c1554044-1553358 [Francisella tularensis subsp. novicida U112]
ATGAGAATATTGTTGGCTGAAGATGATCTTCATTTGGGTGAAGGCTTATTAGAAGCTTTGCAAAAAGAGGGTTTGATTGT
AAATCTAGTTTCAGATGGTGAGGCAGCGCAAACTTTTATAGAATCTGGATTGTATGATATCGTCGTCTTAGATATTGGTA
TGCCAATAAAAACTGGTTTAGAAGTTCTAAGAAATATTAGAAATAGAGGTATTAAAGTACCAATAATACTGTTGACTGCT
AGAGATGGTTTAGAAGATAGAATTAAAGGTCTTGATCTTGGTGCTGATGATTATCTAACTAAGCCATTTGAGTTAAAAGA
GCTAGTAGCTAGAATTAAGGCTATTTCTCGTCGTATTGATACTAGATCTGGTAAAAGTGTTAATGAAGAAATTAGATTTG
GAGATTATAGTTTTAATCCAAGCTCTGAAACGGTAACCAAAGATGGAGTTATTATTCCTGTTTCAAAAAAAGAGTTAGCG
CTTTTAGCTATATTGGTACAAAATGCTGGTAGGGTAGTACCAAAGACACAGCTTTTAGAAGAAGTATATTCCACTGATAA
GGAAATGGATACAAACACCCTAGAAGTACATATGCATAATTTAAGAAAGAAAATTAACATTCCTAATTTTATACAGACTA
TTAGAGGTGTTGGTTACTTTGTACAAAAGGATAAAGTAATTAAGTAA