Detailed information of regulator


Summary

Regulator ID REG0173 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS regulatory pathway
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00158 experimental (Type ii)
Strain Francisella tularensis subsp. novicida U112
Replicon chromosome
Sequence Protein sequence (206 a.a.); Nucleotide sequence (618 bp)
Description RT-PCR analysis show MglA is a positive transcriptional regulator of the iglC operon.; PmrA, MglA, and SspA are parts of the same protein complex.
Reference

External database links

Locus tag (Gene) FTN_RS06610 (mglA)
Coordinates (Strand) 1362282..1362899 (+)
NCBI ID 489124662
RefSeq NC_008601
Uniprot ID A0A1S2WVL9_9GAMM, A0Q7F6_FRATN, O52734_FRANO
KEGG ID fty:CH70_635, ftn:FTN_1290, ftx:AW25_716
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
iglC transcription -
Unknown -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
GST_N_3 PF13417.8 2.1e-06 11..78

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-205 MLLYTKKDDIYSDIVRMILLIKGANAKIVDVSKEENSKHLEELNIITPNGNIPTLSTDDFAVYRLSVIIEAIEDLYPFPPMFPVFPKQRANARILLEYVNKTFLQNIIKLQSPDLDEKQANEIKMLMQRDIISTYKTIVSEREVNAESNPDAQNINVLTLIITFVFYYFIKLKISIPTKDKNIIKEIKELLSEPNFIKTIKAKGA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9813 - -



  Protein sequence of regulator: 206 a.a.    .

>REG0173 NC_008601:1362282-1362899 [Francisella tularensis subsp. novicida U112]
MLLYTKKDDIYSDIVRMILLIKGANAKIVDVSKEENSKHLEELNIITPNGNIPTLSTDDFAVYRLSVIIEAIEDLYPFPP
MFPVFPKQRANARILLEYVNKTFLQNIIKLQSPDLDEKQANEIKMLMQRDIISTYKTIVSEREVNAESNPDAQNINVLTL
IITFVFYYFIKLKISIPTKDKNIIKEIKELLSEPNFIKTIKAKGA*

  Nucleotide sequence of regulator: 618 bp    .

>REG0173 NC_008601:1362282-1362899 [Francisella tularensis subsp. novicida U112]
TTGCTTTTATACACAAAAAAAGATGATATCTATAGCGATATAGTCCGCATGATCCTTCTTATTAAAGGGGCTAATGCGAA
AATTGTAGATGTTTCTAAAGAAGAAAACTCAAAACATCTAGAAGAGCTAAATATCATTACACCTAATGGTAATATACCTA
CGCTTAGCACAGATGATTTTGCAGTGTATAGGCTTAGTGTGATTATAGAAGCTATAGAGGATCTATATCCCTTTCCTCCG
ATGTTTCCAGTATTTCCAAAACAGCGAGCTAATGCAAGAATATTGTTAGAATATGTTAATAAGACGTTTCTACAAAATAT
TATTAAATTACAAAGTCCTGATTTGGATGAAAAACAAGCTAACGAAATAAAAATGCTAATGCAAAGGGATATAATAAGCA
CTTATAAGACAATAGTTAGTGAAAGAGAAGTAAATGCAGAAAGTAATCCAGATGCTCAAAATATCAACGTATTGACTCTG
ATAATAACTTTCGTTTTTTATTATTTCATTAAGTTAAAGATCTCAATACCTACCAAAGATAAAAACATTATCAAAGAGAT
CAAAGAATTACTTAGCGAACCTAACTTTATAAAAACTATCAAAGCAAAAGGAGCTTAA