Detailed information of regulator


Summary

Regulator ID REG0160 experimental
Regulator type protein
Regulatory pathway (from literatures) c-di-GMP regulatory pathway
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00150 experimental (Type i3)
Strain Pseudomonas aeruginosa UCBPP-PA14
Replicon chromosome
Sequence Protein sequence (286 a.a.); Nucleotide sequence (858 bp)
Description Overproduction of the PA2133 phosphodiesterase reverts the T3SS/T6SS switch.
Reference

External database links

Locus tag (Gene) PA14_RS15060 (PA2133 phosphodiesterase)
Coordinates (Strand) 3294000..3294857 (-)
NCBI ID 489200657
RefSeq NC_008463
Uniprot ID A0A0H2ZAP3_PSEAB, A0A0C6FAW2_PSEAI
KEGG ID pau:PA14_36990
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
Hcp1 production -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
EAL PF00563.22 7.2e-41 28..259

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-285 VNSSPQARQHEHPPAVAASLAGDLRLARRFQAALARGRVRLDWQAVRHAGHPEWEPLYRETLLRVTAASGEPPLPTQELILALERLGLIRLLDRCVLGTVLDRLNAEPTLRLACNLSRQSAAMDAWWEAVCRWLAARPQVARRLTLELTETAVGERVATREFIRRLREHGVRIAIDDFGAAHNNLDFVLDARPDVIKIDCRYTREARRSAKGAEVLRHLLALCRELAPCVVLEGLEEDDAFARLPTGDVYLQGNAIAPPMRVEPPLSVRRPKSRARIEALASRQG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9592 - -



  Protein sequence of regulator: 286 a.a.    .

>REG0160 NC_008463:c3294857-3294000 [Pseudomonas aeruginosa UCBPP-PA14]
VNSSPQARQHEHPPAVAASLAGDLRLARRFQAALARGRVRLDWQAVRHAGHPEWEPLYRETLLRVTAASGEPPLPTQELI
LALERLGLIRLLDRCVLGTVLDRLNAEPTLRLACNLSRQSAAMDAWWEAVCRWLAARPQVARRLTLELTETAVGERVATR
EFIRRLREHGVRIAIDDFGAAHNNLDFVLDARPDVIKIDCRYTREARRSAKGAEVLRHLLALCRELAPCVVLEGLEEDDA
FARLPTGDVYLQGNAIAPPMRVEPPLSVRRPKSRARIEALASRQG*

  Nucleotide sequence of regulator: 858 bp    .

>REG0160 NC_008463:c3294857-3294000 [Pseudomonas aeruginosa UCBPP-PA14]
GTGAACAGTTCCCCACAGGCTCGCCAGCACGAGCACCCGCCGGCCGTTGCCGCCTCCCTGGCCGGCGACCTGCGCCTGGC
CCGGCGTTTCCAGGCCGCCCTGGCGCGCGGTCGGGTGCGCCTGGACTGGCAGGCCGTACGGCATGCCGGGCATCCAGAAT
GGGAGCCGCTCTACCGGGAAACCCTGCTCAGGGTCACGGCCGCCAGCGGCGAGCCGCCGTTGCCGACCCAGGAACTGATC
CTGGCGCTGGAGCGGCTCGGCCTGATACGCCTGCTCGATCGCTGCGTGCTGGGCACGGTCCTCGACCGGCTGAACGCCGA
GCCTACCTTGCGCCTGGCCTGCAACCTGTCGCGCCAGAGCGCGGCGATGGATGCCTGGTGGGAAGCCGTCTGCCGATGGC
TGGCCGCCCGTCCGCAGGTGGCACGGCGGCTGACGCTGGAGCTGACCGAGACCGCCGTGGGCGAGAGAGTCGCGACCCGG
GAGTTCATCCGACGCCTGCGCGAACATGGCGTGCGCATCGCGATAGATGACTTCGGCGCGGCGCACAACAACCTGGACTT
CGTCCTCGATGCCCGTCCCGACGTGATCAAGATCGATTGCCGGTATACCCGCGAAGCACGTCGCTCGGCGAAGGGCGCCG
AAGTGCTGCGCCACCTGCTAGCCCTGTGCCGCGAACTGGCGCCCTGCGTGGTCCTGGAAGGTCTCGAGGAGGACGATGCG
TTCGCCCGGCTGCCGACCGGGGACGTCTATCTCCAGGGCAACGCGATCGCGCCGCCGATGCGGGTCGAACCGCCGCTGTC
CGTACGCCGGCCGAAGAGCCGGGCGCGGATCGAGGCGCTGGCGAGCCGCCAGGGGTGA