Detailed information of regulator


Summary

Regulator ID REG0158 experimental
Regulator type protein
Regulatory pathway (from literatures) RsmA regulatory pathway
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Biofilm formation - Vibrio cholerae (map05111); Biofilm formation - Pseudomonas aeruginosa (map02025); Biofilm formation - Escherichia coli (map02026)
Related T6SS T6SS00150 experimental (Type i3)
Strain Pseudomonas aeruginosa UCBPP-PA14
Replicon chromosome
Sequence Protein sequence (62 a.a.); Nucleotide sequence (186 bp)
Description RsmA Directly Binds the rsmF Transcript and Represses RsmF Translation. Examination of the 5′UTR of rsmF revealed a putative RsmA-binding site (GCAAGGACGC) that closely matches the consensus (A/UCANGGANGU/A), which is confirmed by 5′ RACE.; EMSA experiments using rabiolabeled RNA hairpins encompassing the previously identified tssA1 RsmA-binding site (AUAGGGAGAT).; RNA EMSA experiments shows RsmA-His bound both the rsmA and rsmF probes with a Keq of 68 nM and 55 nM, respectively. Binding was specific, as it could not be competitively inhibited by the addition of excess nonspecific RNA.
Reference

External database links

Locus tag (Gene) PA14_52570 (RsmA)
Coordinates (Strand) 4660393..4660578 (-)
NCBI ID 489176459
RefSeq NC_008463
Uniprot ID M4WWL5_9PSED, A0A024HEC5_PSEKB, V6AK05_PSEAI, A0A1C7BJS7_PSEAI, A0A078LPH4_9PSED, A0A1S1GPX1_9PSED, A0A0F0DWV5_9PSED, A0A1B8V9Z3_9PSED, A0A1B8TAL7_9PSED, A0A1V9UZJ2_9PSED, CSRA_PSEAB, CSRA_PSEAE, A0A2V2TBX2_9PSED, A0A2N8S2I6_PSEST, A0A239JD89_9PSED, A6VA69_PSEA7, A0A1G8C1S4_9PSED, A0A239BH34_9PSED, A0A0V8T2D1_PSESD, A0A127MPL9_9PSED, CSRA_PSEA8, W5IVP6_PSEUO
KEGG ID pae:PA0905, pkc:PKB_1603, pag:PLES_44111, pap:PSPA7_4610, pcq:PcP3B5_15810, pau:PA14_52570, pdr:H681_08660
KEGG pathway (determined by BlastKOALA) map02020; map05111; map02025; map02026
PDB ID 1VPZ

  Target
Target Regulation (↓/↑) Target sequence
RSMF GCAAGGACGC
tssA1 RNA AUAGGGAGAT
RSMA -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
CsrA PF02599.18 7.2e-26 1..53

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-61 MLILTRRVGETLMVGDDVTVTVLGVKGNQVRIGVNAPKEVAVHREEIYQRIQKEKDQEPNH



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9779 - -



  Protein sequence of regulator: 62 a.a.    .

>REG0158 NC_008463:c4660578-4660393 [Pseudomonas aeruginosa UCBPP-PA14]
MLILTRRVGETLMVGDDVTVTVLGVKGNQVRIGVNAPKEVAVHREEIYQRIQKEKDQEPNH*

  Nucleotide sequence of regulator: 186 bp    .

>REG0158 NC_008463:c4660578-4660393 [Pseudomonas aeruginosa UCBPP-PA14]
ATGCTGATTCTGACTCGTCGGGTCGGAGAGACCCTGATGGTAGGTGACGACGTCACCGTGACGGTACTGGGTGTCAAAGG
GAACCAGGTGCGCATCGGCGTCAACGCGCCGAAGGAAGTCGCCGTGCACCGGGAGGAAATTTACCAGCGCATCCAGAAAG
AGAAAGATCAAGAGCCAAACCATTAA