Detailed information of regulator


Summary

Regulator ID REG0155 experimental
Regulator type protein
Regulatory pathway (from literatures) QS regulatory pathway
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Quorum sensing (map02024)
Related T6SS T6SS00115 experimental (Type i4b)
Strain Burkholderia thailandensis E264
Replicon chromosome
Sequence Protein sequence (240 a.a.); Nucleotide sequence (720 bp)
Description QS activates nine genes for T6SS-1 substrates.
Reference

External database links

Locus tag (Gene) BTH_II1510 (BtaR1)
Coordinates (Strand) 1779070..1779789 (-)
NCBI ID 497583165
RefSeq NC_007650
Uniprot ID A0A1B4K3P4_BURTH, Q2T543_BURTA
KEGG ID bte:BTH_II1510, btha:DR62_3487
KEGG pathway (determined by BlastKOALA) map02020; map02024
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
BTH_I2691/BTH_I2693-99/BTH_I2701-702 -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Autoind_bind PF03472.17 7e-34 18..157
GerE PF00196.21 4.2e-19 175..230

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-239 MELRWQDAYLQFSAAENEQQLFQQIAAYTKRLGFEYCCYGIRVPLPISKPVVAIFDTYPNGWMERYQEMNYLEVDPTVRDGALSSNMIVWPEASANDATTLWSDARDHGLAVGVAQSSWASRGVFGLLTIARHTDRLTSAEINHLTLQANWLANMSHSLMSRFLVPKLAPESGVALTHREREVLCWTGEGKTACEIGQILSISERTVNFHVNNILDKLGATNKVQAVVKAIAMGLIDTP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9820 - -



  Protein sequence of regulator: 240 a.a.    .

>REG0155 NC_007650:c1779789-1779070 [Burkholderia thailandensis E264]
MELRWQDAYLQFSAAENEQQLFQQIAAYTKRLGFEYCCYGIRVPLPISKPVVAIFDTYPNGWMERYQEMNYLEVDPTVRD
GALSSNMIVWPEASANDATTLWSDARDHGLAVGVAQSSWASRGVFGLLTIARHTDRLTSAEINHLTLQANWLANMSHSLM
SRFLVPKLAPESGVALTHREREVLCWTGEGKTACEIGQILSISERTVNFHVNNILDKLGATNKVQAVVKAIAMGLIDTP*

  Nucleotide sequence of regulator: 720 bp    .

>REG0155 NC_007650:c1779789-1779070 [Burkholderia thailandensis E264]
ATGGAACTGCGCTGGCAAGACGCCTATCTTCAATTTAGCGCCGCGGAGAACGAGCAGCAGCTCTTCCAACAGATCGCAGC
GTATACGAAGCGGCTCGGCTTCGAATATTGCTGCTATGGCATACGTGTGCCGCTGCCGATCTCGAAGCCGGTCGTCGCGA
TCTTCGACACCTATCCGAACGGCTGGATGGAGCGCTATCAGGAAATGAACTACCTGGAGGTCGATCCGACCGTGCGCGAC
GGCGCGCTCAGCTCGAACATGATCGTCTGGCCGGAGGCGAGCGCGAACGATGCGACGACGCTGTGGAGCGACGCGCGCGA
TCACGGGCTCGCAGTCGGCGTCGCGCAGTCGAGCTGGGCATCGCGCGGTGTGTTCGGCCTCCTGACGATCGCGCGGCACA
CGGACCGCCTGACGTCCGCCGAGATCAACCATCTGACGCTTCAGGCGAACTGGCTCGCGAACATGTCGCACTCGTTGATG
AGCCGCTTCCTCGTGCCGAAGCTCGCGCCCGAATCGGGCGTGGCGCTCACGCACCGCGAGCGGGAAGTGCTGTGCTGGAC
GGGCGAGGGCAAGACCGCGTGCGAGATCGGCCAGATCCTCAGCATTTCCGAGCGCACGGTGAACTTCCACGTCAACAACA
TCCTCGACAAGCTCGGCGCGACGAACAAGGTGCAGGCCGTCGTGAAGGCGATCGCGATGGGGCTCATCGATACGCCGTGA