Detailed information of regulator


Summary

Regulator ID REG0148 experimental
Regulator type protein
Regulatory pathway (from literatures) (p)ppGpp regulatory pathway
KEGG pathway (determined by BlastKOALA) Metabolic pathways (map01100); Purine metabolism (map00230)
Related T6SS T6SS00086 experimental (Type i4b)
Strain Pseudomonas syringae pv. syringae B728a
Replicon chromosome
Sequence Protein sequence (748 a.a.); Nucleotide sequence (2244 bp)
Description 28 putative T6SS-associated genes of PstDC3000 and 25 T6SS-related genes of PssB728a were down-regulated in the (p)ppGpp0PstDC3000 and (p)ppGpp0PssB728a mutants, respectively.
Reference

External database links

Locus tag (Gene) PSYR_RS19090 (relA)
Coordinates (Strand) 4380642..4382885 (-)
NCBI ID 499587809
RefSeq NC_007005
Uniprot ID Q4ZQ45_PSEU2, A0A108ULB7_PSESY
KEGG ID psb:Psyr_3695
KEGG pathway (determined by BlastKOALA) map01100; map00230
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
T6SS transcripts -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
HD_4 PF13328.8 3.5e-44 40..202
RelA_SpoT PF04607.19 9.9e-38 262..370
TGS PF02824.23 7.9e-22 416..475
ACT_4 PF13291.8 8.2e-17 667..743
DUF5913 PF19296.1 2.7e-08 494..637

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-747 MVQVRANQPINTDGSINLDAWLDHIVSVDLVLDREVMKKACEFAREAEQTDKAHKNHWAEGTSSFQTGLEIAEILADLKLDQDSLVAAVIYRGVREGLIALPDVEQRFGATVAKLIDGVLRMAAISASLSPRQSLVLGSQAQVENLRKMLVAMVDDVRVALIKLAERTCAIRAVKNADDEKRNRVAREVFDIYAPLAHRLGIGHIKWELEDLSFRYLEPDQYKQIAKLLHERRLDRERFISDVMSQLDNELQATGVTADISGRAKHIYSIWRKMQRKGLAFSQIYDVRALRVLVPEMRDCYTALGIVHTLWRHIPKEFDDYIANPKENGYRSLHTAVIGPEGKVLEVQIRTHAMHEEAELGVCAHWRYKGTDVKSGSNHYEEKISWLRQVLEWHEELGDIGGLADQLRVDIEPDRVYVFTPDGHAIDLPKGATPLDFAYRVHTEIGHNCRGAKINGRIVPLNYSLQTGEQVEIITSKHGTPSRDWLNSNLGYITTSRARAKIVHWFKLQARDQNVAAGRTLIERELARLALPQVDFDKLADKANHKTADDMFAALGAGDLRLAQLVNLAQQQVEPDRVNEQLELIPRKATGYKPGKRGDIQIQGVGNLMTQMAGCCQPLPGDAIVGYITQGRGVSIHRQDCASVLQLGGREPERIIQVSWGPVPVLTYPVDIIIRAYDRSGLLRDVTQVLLNERINVLAVNTRSNKEDNTALMSLTIEIPGLDALGRLLGRISQLPNIIETRRNRTP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9966 - -



  Protein sequence of regulator: 748 a.a.    .

>REG0148 NC_007005:c4382885-4380642 [Pseudomonas syringae pv. syringae B728a]
MVQVRANQPINTDGSINLDAWLDHIVSVDLVLDREVMKKACEFAREAEQTDKAHKNHWAEGTSSFQTGLEIAEILADLKL
DQDSLVAAVIYRGVREGLIALPDVEQRFGATVAKLIDGVLRMAAISASLSPRQSLVLGSQAQVENLRKMLVAMVDDVRVA
LIKLAERTCAIRAVKNADDEKRNRVAREVFDIYAPLAHRLGIGHIKWELEDLSFRYLEPDQYKQIAKLLHERRLDRERFI
SDVMSQLDNELQATGVTADISGRAKHIYSIWRKMQRKGLAFSQIYDVRALRVLVPEMRDCYTALGIVHTLWRHIPKEFDD
YIANPKENGYRSLHTAVIGPEGKVLEVQIRTHAMHEEAELGVCAHWRYKGTDVKSGSNHYEEKISWLRQVLEWHEELGDI
GGLADQLRVDIEPDRVYVFTPDGHAIDLPKGATPLDFAYRVHTEIGHNCRGAKINGRIVPLNYSLQTGEQVEIITSKHGT
PSRDWLNSNLGYITTSRARAKIVHWFKLQARDQNVAAGRTLIERELARLALPQVDFDKLADKANHKTADDMFAALGAGDL
RLAQLVNLAQQQVEPDRVNEQLELIPRKATGYKPGKRGDIQIQGVGNLMTQMAGCCQPLPGDAIVGYITQGRGVSIHRQD
CASVLQLGGREPERIIQVSWGPVPVLTYPVDIIIRAYDRSGLLRDVTQVLLNERINVLAVNTRSNKEDNTALMSLTIEIP
GLDALGRLLGRISQLPNIIETRRNRTP*

  Nucleotide sequence of regulator: 2244 bp    .

>REG0148 NC_007005:c4382885-4380642 [Pseudomonas syringae pv. syringae B728a]
ATGGTACAGGTGAGAGCGAACCAGCCGATAAACACAGACGGCAGTATCAATCTCGACGCGTGGCTCGATCATATTGTCAG
CGTCGACCTGGTCCTGGACCGGGAAGTCATGAAAAAGGCCTGTGAATTTGCCCGGGAAGCCGAGCAGACCGACAAGGCTC
ACAAGAATCATTGGGCAGAGGGCACCTCCAGTTTCCAGACCGGTCTGGAAATCGCGGAGATCCTGGCTGACCTCAAGCTG
GATCAGGACTCGCTGGTCGCTGCGGTCATTTACCGTGGCGTGCGTGAAGGTCTCATTGCGCTGCCGGACGTCGAGCAGCG
CTTTGGCGCAACGGTCGCCAAACTCATCGACGGCGTGCTGCGCATGGCCGCGATCAGCGCCAGCCTCAGCCCTCGTCAGT
CATTGGTGCTCGGCAGTCAGGCGCAGGTGGAAAACCTGCGCAAGATGCTGGTGGCGATGGTCGACGACGTTCGCGTTGCG
CTGATCAAGCTGGCCGAACGTACCTGCGCGATTCGTGCGGTGAAGAATGCCGACGACGAAAAACGCAACCGTGTGGCTCG
CGAAGTCTTCGACATCTATGCGCCACTGGCCCACCGCCTGGGTATCGGGCATATCAAGTGGGAGCTGGAGGACCTGTCCT
TCCGCTACCTGGAGCCCGATCAATACAAGCAGATCGCCAAGCTGCTGCATGAACGCAGGCTGGACCGCGAGCGCTTCATC
AGCGACGTCATGTCTCAACTCGATAACGAGCTGCAGGCCACCGGCGTGACCGCTGACATCAGCGGTCGTGCCAAGCATAT
CTACTCCATCTGGCGCAAAATGCAGCGCAAGGGCCTGGCGTTCAGCCAGATCTATGACGTGCGTGCGTTGCGTGTGCTGG
TCCCGGAAATGCGCGACTGCTACACCGCGCTGGGTATCGTGCACACCTTGTGGCGGCATATTCCCAAAGAGTTCGACGAT
TACATCGCCAACCCCAAGGAAAACGGCTATCGCTCGCTGCACACCGCCGTGATCGGGCCGGAAGGCAAGGTGCTGGAAGT
GCAGATCCGCACCCACGCCATGCATGAAGAGGCCGAGCTGGGCGTTTGTGCGCACTGGCGCTATAAAGGCACCGACGTCA
AATCCGGCTCCAATCATTACGAAGAGAAGATTTCCTGGCTGCGTCAGGTGCTCGAATGGCATGAGGAGCTGGGCGACATC
GGCGGTCTGGCCGATCAGTTGCGGGTTGATATCGAGCCCGACCGCGTCTACGTCTTCACCCCGGACGGCCACGCCATCGA
CCTGCCCAAGGGCGCGACACCGCTGGACTTCGCCTATCGGGTGCACACCGAAATCGGCCATAACTGCCGGGGTGCGAAGA
TCAATGGCCGCATCGTACCGCTCAACTACAGCCTGCAGACCGGCGAGCAGGTCGAGATCATCACCAGCAAGCACGGTACG
CCGAGCCGCGACTGGCTGAACTCGAACCTGGGCTACATCACCACCTCGCGCGCGCGGGCCAAGATCGTTCACTGGTTCAA
GTTGCAGGCTCGCGACCAGAACGTCGCCGCCGGCAGAACCCTGATCGAACGCGAACTGGCGCGCCTGGCGTTACCGCAGG
TCGATTTCGACAAGCTGGCGGACAAGGCCAATCACAAGACCGCCGACGACATGTTTGCGGCATTGGGCGCGGGCGATCTG
CGTCTGGCGCAACTGGTCAATCTGGCTCAGCAGCAGGTTGAGCCTGATCGCGTCAATGAACAGCTGGAGCTGATCCCGCG
CAAGGCCACCGGCTACAAGCCCGGCAAGCGTGGCGATATTCAGATTCAGGGCGTCGGCAACCTGATGACGCAGATGGCCG
GCTGCTGCCAGCCGCTGCCGGGCGATGCGATCGTCGGTTATATCACTCAGGGGCGTGGCGTCAGCATTCACCGTCAGGAT
TGCGCTTCGGTGCTGCAATTGGGCGGTCGCGAGCCCGAGCGGATCATTCAGGTCAGTTGGGGGCCGGTGCCGGTACTCAC
CTATCCGGTGGACATCATCATCCGTGCCTACGACCGTTCCGGCTTGCTCCGGGACGTCACCCAGGTGCTGCTCAACGAGC
GGATCAACGTGCTGGCGGTCAATACCCGTTCGAACAAGGAAGACAACACAGCGCTCATGTCTCTGACCATCGAGATTCCG
GGTCTGGACGCGCTGGGGCGGTTGCTGGGGCGCATTTCCCAGCTGCCGAACATCATTGAAACGCGCAGGAACAGGACGCC
CTAG