Detailed information of regulator


Summary

Regulator ID REG0147 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS-RR
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Quorum sensing (map02024)
Related T6SS T6SS00081 experimental (Type ii)
Strain Francisella tularensis subsp. tularensis SCHU S4
Replicon chromosome
Sequence Protein sequence (229 a.a.); Nucleotide sequence (687 bp)
Description Comparison of gene expression in F. novicida ΔpmrA and wild-type F. novicida, determined by microarray analysis and qRT-PCR shows 11 of the 52 PmrA-activated genes were located in the FPI (e.g., pdpD, iglC, and iglD).
Reference

External database links

Locus tag (Gene) FTT1557c/FNU0663.2 (pmrA)
Coordinates (Strand) 1618742..1619428 (-)
NCBI ID 489108239
RefSeq NC_006570
Uniprot ID A0A0E2ZK20_FRATU, A0A1J0KQ81_FRANO, A0Q7W8_FRATN, Q5NER1_FRATT
KEGG ID ftx:AW25_536, ftu:FTT_1557c, ftn:FTN_1465, fty:CH70_465
KEGG pathway (determined by BlastKOALA) map02020; map02024
PDB ID 5UIC

  Target
Target Regulation (↓/↑) Target sequence
T6SS transcription -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Response_reg PF00072.26 2e-25 3..113
Trans_reg_C PF00486.30 1.5e-22 152..220

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-228 MRILLAEDDLHLGEGLLEALQKEGLIVNLVSDGEAAQTFIESGLYDIVVLDIGMPIKTGLEVLRNIRNRGIKVPIILLTARDGLEDRIKGLDLGADDYLTKPFELKELVARIKAISRRIDTRSGKSVNEEIRFGDYSFNPSSETVTKDGVIIPVSKKELALLAILVQNAGRVVPKTQLLEEVYSTDKEMDTNTLEVHMHNLRKKINIPNFIQTIRGVGYFVQKDKVIK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9977 - -



  Protein sequence of regulator: 229 a.a.    .

>REG0147 NC_006570:c1619428-1618742 [Francisella tularensis subsp. tularensis SCHU S4]
MRILLAEDDLHLGEGLLEALQKEGLIVNLVSDGEAAQTFIESGLYDIVVLDIGMPIKTGLEVLRNIRNRGIKVPIILLTA
RDGLEDRIKGLDLGADDYLTKPFELKELVARIKAISRRIDTRSGKSVNEEIRFGDYSFNPSSETVTKDGVIIPVSKKELA
LLAILVQNAGRVVPKTQLLEEVYSTDKEMDTNTLEVHMHNLRKKINIPNFIQTIRGVGYFVQKDKVIK*

  Nucleotide sequence of regulator: 687 bp    .

>REG0147 NC_006570:c1619428-1618742 [Francisella tularensis subsp. tularensis SCHU S4]
ATGAGAATATTGTTGGCTGAAGATGATCTTCATTTGGGTGAAGGCTTATTAGAAGCTTTGCAAAAAGAGGGTTTGATTGT
AAATCTAGTTTCAGATGGTGAGGCAGCGCAAACTTTTATAGAATCTGGATTGTATGATATAGTCGTCTTAGATATTGGTA
TGCCAATAAAAACTGGTTTAGAAGTTCTAAGAAATATTAGAAATAGAGGTATTAAAGTACCAATAATACTGTTGACTGCT
AGAGATGGTTTAGAAGATAGAATTAAAGGTCTTGATCTTGGTGCTGATGATTATCTAACTAAGCCATTTGAGTTAAAAGA
GCTAGTAGCTAGAATTAAAGCTATTTCTCGTCGTATTGATACTAGATCTGGTAAAAGTGTTAATGAAGAAATTAGATTTG
GAGATTATAGTTTTAATCCAAGCTCTGAAACGGTAACCAAAGATGGAGTTATTATTCCTGTTTCAAAAAAAGAGTTAGCG
CTTTTAGCTATATTGGTACAAAATGCTGGTAGGGTAGTACCAAAGACACAGCTTTTAGAAGAAGTATATTCTACTGATAA
GGAAATGGATACAAACACCCTAGAAGTACATATGCATAATTTAAGAAAGAAAATTAACATTCCTAATTTTATACAGACTA
TTAGAGGTGTTGGTTACTTTGTACAAAAGGATAAAGTAATTAAGTAA