Detailed information of regulator


Summary

Regulator ID REG0139 experimental
Regulator type protein
Regulatory pathway (from literatures) bspR-dependent signalling cascade
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00077 insolico (Type i4b)
Strain Burkholderia pseudomallei K96243
Replicon chromosome
Sequence Protein sequence (211 a.a.); Nucleotide sequence (633 bp)
Description bspR (bsa‐specific regulator) Deletion of bspR, bprP or bsaN reduced the expression of T6SS5 genes to less than 8% of wild‐type level.
Reference

External database links

Locus tag (Gene) BPSL1105 (bprP)
Coordinates (Strand) 1275668..1276300 (+)
NCBI ID 490290369
RefSeq NC_006350
Uniprot ID A0A0F6L8Q3_BURPE, A0A0H2WKG3_BURMA, Q63VZ0_BURPS, D7SD96_BURPE, A0A0E1W268_BURPE, Q3JUK5_BURP1, A3N7A5_BURP6, B1HBG4_BURPE, C4AMJ3_BURML, A3NSZ3_BURP0, A8EFZ9_BURPE, A2S4G2_BURM9, A0A0E1S7P2_BURPE, C4KTH4_BURPE, A0A0E1UA53_BURPE, A0A0E1UNR6_BURPE, A0A0H3HRZ8_BURP2
KEGG ID bpl:BURPS1106A_1185, bpr:GBP346_A1205, bma:BMA1929, bml:BMA10229_A0841, bps:BPSL1105, bpz:BP1026B_I2432, bpm:BURPS1710b_1338, bpd:BURPS668_1177, but:X994_1612
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
tssA expression -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
TetR_C_29 PF17938.3 7.8e-41 85..201
TetR_N PF00440.25 1.2e-12 17..63

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-210 MNQPKIKRDPEGTRRRILLAAAEEFATGGLFGARVDQIARRAETNERMLYYYFGSKEQLFTAVLEYAFSALMEAERAIDLEGVAPVEAITRLAHFVWDYYRDHPDLLRLLNNENLHEARYLQKSTRIREMISPIVKTLDGVLERGQKAGLFRTDIDSLRFYVTLSGLGYYMVSNRFTLAAIFGRDFSAQHERAEMVKMNTELLLAFLLRR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8719 - -



  Protein sequence of regulator: 211 a.a.    .

>REG0139 NC_006350:1275668-1276300 [Burkholderia pseudomallei K96243]
MNQPKIKRDPEGTRRRILLAAAEEFATGGLFGARVDQIARRAETNERMLYYYFGSKEQLFTAVLEYAFSALMEAERAIDL
EGVAPVEAITRLAHFVWDYYRDHPDLLRLLNNENLHEARYLQKSTRIREMISPIVKTLDGVLERGQKAGLFRTDIDSLRF
YVTLSGLGYYMVSNRFTLAAIFGRDFSAQHERAEMVKMNTELLLAFLLRR*

  Nucleotide sequence of regulator: 633 bp    .

>REG0139 NC_006350:1275668-1276300 [Burkholderia pseudomallei K96243]
ATGAATCAGCCAAAAATCAAAAGAGACCCAGAGGGAACCCGGCGCCGGATCCTGCTCGCGGCGGCCGAAGAGTTCGCGAC
AGGGGGGCTGTTCGGTGCGCGAGTCGACCAGATCGCGCGCCGCGCCGAGACCAACGAGCGGATGCTCTATTACTACTTCG
GCAGCAAGGAGCAATTGTTTACCGCGGTGCTCGAATACGCGTTTTCCGCGCTGATGGAGGCCGAGCGGGCGATCGATCTC
GAAGGCGTCGCGCCCGTCGAGGCGATCACGCGGCTCGCGCATTTCGTGTGGGACTACTATCGCGATCATCCCGATTTGCT
GCGCCTGCTCAACAACGAGAATCTGCACGAGGCGCGCTATTTGCAGAAATCGACGCGCATCCGCGAGATGATCTCGCCGA
TCGTCAAGACGCTCGACGGCGTGCTCGAGCGCGGCCAGAAGGCGGGACTCTTTCGCACGGACATCGATTCGCTGCGGTTC
TACGTGACGCTGTCGGGGCTCGGCTACTACATGGTGTCGAACCGCTTCACGCTCGCCGCGATCTTCGGCCGCGATTTCAG
CGCGCAGCACGAGCGCGCCGAGATGGTCAAGATGAACACCGAGTTGCTGCTCGCGTTTCTGTTGAGGCGCTGA