Detailed information of regulator


Summary

Regulator ID REG0135 experimental
Regulator type protein
Regulatory pathway (from literatures) BsaN regulon
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00077 insolico (Type i4b)
Strain Burkholderia pseudomallei K96243
Replicon chromosome
Sequence Protein sequence (172 a.a.); Nucleotide sequence (516 bp)
Description BsaN together with chaperone BicA directly activate T6SS1 regulatory genes, and bsaN/bicA expression constructs resulted in activation of T6SS1 regulatory gene BPSS 1495(virA).
Reference

External database links

Locus tag (Gene) BPS_RS27070 (bicA)
Coordinates (Strand) 2087441..2087956 (-)
NCBI ID 490293043
RefSeq NC_006351
Uniprot ID A0A0F6L1C9_BURPE, Q63K33_BURPS, A0A069B9Y9_BURPE, B1H8M3_BURPE, C4AWI9_BURML, A3P6Z8_BURP0, A8EPL3_BURPE, A2S1P7_BURM9, A0A0E1S5A7_BURPE, C4I6K4_BURPE, A0A0E1TMP5_BURPE, A0A0E1UN71_BURPE
KEGG ID bpl:BURPS1106A_A2075, bml:BMA10229_2070, bps:BPSS1533, but:X994_5584
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
BPSS 1495(virA) -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
TPR_3 PF07720.14 3.5e-11 41..74
TPR_3 PF07720.14 7.9e-07 76..108

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-171 MTQRDVNIDDIEAQEMAAALLDAVQNGATLKDLHQVPQDLMDGIYAFAYRFYQQGRLDDAEVFFRFLCIYDFYNAEYAMGLAAVCQLKKEYARAIDLYALAYSLSKDDHRPMFHTGQCHLLMGKAALARRCFGIVVERSRDERLAQKAQSYLDGLDEVGADAAPASAGNDH



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9961 - -



  Protein sequence of regulator: 172 a.a.    .

>REG0135 NC_006351:c2087956-2087441 [Burkholderia pseudomallei K96243]
MTQRDVNIDDIEAQEMAAALLDAVQNGATLKDLHQVPQDLMDGIYAFAYRFYQQGRLDDAEVFFRFLCIYDFYNAEYAMG
LAAVCQLKKEYARAIDLYALAYSLSKDDHRPMFHTGQCHLLMGKAALARRCFGIVVERSRDERLAQKAQSYLDGLDEVGA
DAAPASAGNDH*

  Nucleotide sequence of regulator: 516 bp    .

>REG0135 NC_006351:c2087956-2087441 [Burkholderia pseudomallei K96243]
ATGACGCAACGCGACGTGAACATAGACGACATCGAGGCGCAGGAAATGGCGGCGGCGCTGCTGGACGCGGTCCAGAACGG
CGCGACGCTGAAGGACCTGCATCAGGTGCCGCAGGACCTGATGGACGGCATCTATGCGTTCGCGTACCGCTTCTACCAGC
AGGGGCGGCTCGACGACGCGGAGGTGTTCTTCCGCTTTCTGTGCATCTACGACTTCTACAACGCCGAATACGCGATGGGG
CTCGCGGCGGTGTGCCAGTTGAAGAAGGAGTACGCGCGGGCGATCGATCTGTATGCACTCGCGTATTCGCTGTCGAAGGA
CGACCACCGGCCGATGTTCCACACCGGCCAATGCCATCTGCTGATGGGCAAGGCGGCGCTCGCGCGGCGCTGCTTCGGCA
TCGTCGTCGAGCGCTCGCGCGACGAGCGCCTCGCGCAGAAGGCGCAGTCCTATCTCGACGGGCTCGACGAAGTGGGCGCC
GACGCGGCGCCCGCATCCGCCGGGAACGACCACTAG