Detailed information of regulator


Summary

Regulator ID REG0127 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS-RR
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00070 experimental (Type i1)
Strain Burkholderia mallei ATCC 23344
Replicon chromosome
Sequence Protein sequence (246 a.a.); Nucleotide sequence (738 bp)
Description virAG and BMAA1517 independently control transcription of this T6S cluster.VirAG and BMAA1517 sense specific conditions in the host environment, and in response, activate the cluster 1 T6S genes.
Reference

External database links

Locus tag (Gene) BMAA0746 (VirG)
Coordinates (Strand) 764773..765510 (+)
NCBI ID 490311617
RefSeq NC_006349
Uniprot ID A5PM41_BURML, A0A0F6L0I3_BURPE, A0A0H2WEE5_BURMA, A0A095S1R3_BURPE, C4B108_BURML, A2RXV9_BURM9, C4I6F5_BURPE, A0A0E1TUR7_BURPE, A0A0E1UNP9_BURPE
KEGG ID bma:BMAA0746, bmal:DM55_4696, bmaq:DM76_3648, bmai:DM57_11860, bml:BMA10229_0713, bmae:DM78_3363
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
Hcp1 (BMAA0742) expression -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Trans_reg_C PF00486.30 4.4e-20 161..235
Response_reg PF00072.26 7.4e-20 10..118

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-245 MTNVTRSPAVLVVEDDEPLRRVLCNYLSGHGMAVDGVGTAAAAAESVGRREYEMVLLDLGLPDGDGIDVLLRWRETQRFPLICVTGRSEEADRIMGLEFGADDYVVKPYSLREVLARMRALWRRAEPSTTPVRRGRHPRAYRFDGWTLNMNTRRLLTRDAQEIPLTVGEFNLLAFFLGSPSRVVTRAQLLECTRAFDDVFDRAVDVQIWRLRKKIEKDPKHPELIRTERGVGYYFDAKEVETLWG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8795 - -



  Protein sequence of regulator: 246 a.a.    .

>REG0127 NC_006349:764773-765510 [Burkholderia mallei ATCC 23344]
MTNVTRSPAVLVVEDDEPLRRVLCNYLSGHGMAVDGVGTAAAAAESVGRREYEMVLLDLGLPDGDGIDVLLRWRETQRFP
LICVTGRSEEADRIMGLEFGADDYVVKPYSLREVLARMRALWRRAEPSTTPVRRGRHPRAYRFDGWTLNMNTRRLLTRDA
QEIPLTVGEFNLLAFFLGSPSRVVTRAQLLECTRAFDDVFDRAVDVQIWRLRKKIEKDPKHPELIRTERGVGYYFDAKEV
ETLWG*

  Nucleotide sequence of regulator: 738 bp    .

>REG0127 NC_006349:764773-765510 [Burkholderia mallei ATCC 23344]
ATGACGAATGTGACAAGATCGCCGGCGGTGCTCGTCGTCGAGGACGACGAACCGTTGCGGCGCGTGCTTTGCAATTACCT
GTCGGGCCACGGGATGGCCGTGGACGGCGTGGGAACGGCGGCAGCGGCCGCCGAATCGGTCGGGCGGCGCGAATACGAGA
TGGTGCTGCTCGATCTCGGCCTGCCGGACGGCGACGGCATCGACGTGCTGCTGCGCTGGCGCGAAACGCAGCGCTTTCCG
CTCATCTGCGTGACGGGGCGCAGCGAAGAGGCCGATCGCATCATGGGCCTCGAATTCGGCGCGGACGATTACGTCGTGAA
GCCGTACTCGCTGCGCGAGGTGCTCGCCCGGATGCGCGCGCTGTGGCGGCGCGCCGAGCCGTCGACGACGCCCGTGCGGC
GCGGCAGGCATCCGCGTGCGTACCGCTTCGACGGATGGACGCTGAACATGAACACGCGCCGGCTGTTGACGCGCGATGCG
CAGGAAATTCCGCTGACGGTCGGCGAATTCAACCTGCTCGCGTTCTTTCTCGGCTCGCCGTCGCGCGTCGTCACGCGCGC
GCAGTTGCTCGAGTGCACGCGTGCGTTCGACGACGTGTTCGATCGCGCGGTCGACGTGCAGATCTGGCGGCTGCGCAAGA
AAATCGAGAAGGATCCGAAGCATCCCGAACTGATTCGAACCGAGCGGGGCGTCGGCTACTACTTCGACGCGAAAGAGGTG
GAGACGCTATGGGGATGA