Detailed information of regulator


Summary

Regulator ID REG0092 experimental
Regulator type protein
Regulatory pathway (from literatures) Tpp
KEGG pathway (determined by BlastKOALA) Bacterial secretion system (map03070); Biofilm formation - Pseudomonas aeruginosa (map02025)
Related T6SS T6SS00035 experimental (Type i3)
Strain Pseudomonas protegens Pf-5
Replicon chromosome
Sequence Protein sequence (245 a.a.); Nucleotide sequence (735 bp)
Description The type VI secretion system of P. protegens Pf-5 is repressed by the threonine phosphorylation pathway.
Reference

External database links

Locus tag (Gene) PFL_RS30815 (pppA)
Coordinates (Strand) 6902924..6903658 (-)
NCBI ID 499376669
RefSeq NC_004129
Uniprot ID A0A1K2AB20_9PSED, A0A2C9EVQ5_PSEPH, A0A2T0Z775_9PSED, Q4K3P6_PSEF5
KEGG ID pprc:PFLCHA0_c60380, pfl:PFL_6079
KEGG pathway (determined by BlastKOALA) map03070; map02025
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
Hcp secretion -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
PP2C_2 PF13672.8 2.7e-11 22..212

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-244 MRSAPQLSYQSASYSHVGMVRKINEDAWLEAPETGLWLVADGMGGHAAGDYVSSLIVDSLRAVPAADSLDDYVAALRNGLAAVNAAVREETANRGVTMMGSTVVLLAVRGARAVCLWAGDSRLYRLRDEQLEGISRDHSYVQDLQDSGLLSEAEARVHPRANIVTRAIGVEAQLELSQIDLQVQDGDTFLLCSDGLNKTAEDFELRDVLSHSEPNDVVRSLIHLGLTRGAPDNITAIVIKAAGH



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9830 - -



  Protein sequence of regulator: 245 a.a.    .

>REG0092 NC_004129:c6903658-6902924 [Pseudomonas protegens Pf-5]
MRSAPQLSYQSASYSHVGMVRKINEDAWLEAPETGLWLVADGMGGHAAGDYVSSLIVDSLRAVPAADSLDDYVAALRNGL
AAVNAAVREETANRGVTMMGSTVVLLAVRGARAVCLWAGDSRLYRLRDEQLEGISRDHSYVQDLQDSGLLSEAEARVHPR
ANIVTRAIGVEAQLELSQIDLQVQDGDTFLLCSDGLNKTAEDFELRDVLSHSEPNDVVRSLIHLGLTRGAPDNITAIVIK
AAGH*

  Nucleotide sequence of regulator: 735 bp    .

>REG0092 NC_004129:c6903658-6902924 [Pseudomonas protegens Pf-5]
ATGCGTTCAGCGCCGCAACTGTCCTACCAGTCCGCCAGCTACAGCCATGTCGGCATGGTGCGGAAAATCAATGAAGACGC
CTGGCTCGAAGCCCCGGAGACCGGCCTGTGGCTGGTGGCCGACGGTATGGGCGGGCACGCCGCCGGGGACTATGTCAGCA
GCCTGATCGTCGACAGCCTGCGGGCGGTTCCGGCCGCCGACAGCCTGGACGACTATGTCGCCGCGCTGCGCAACGGCCTG
GCCGCGGTCAACGCCGCGGTGCGCGAGGAAACCGCCAACCGTGGGGTGACCATGATGGGCAGCACCGTGGTGCTGCTGGC
GGTACGCGGGGCCCGGGCCGTGTGCCTGTGGGCCGGCGACAGCCGCCTGTACCGGTTGCGGGACGAACAGCTGGAAGGCA
TTTCCCGGGACCACAGCTACGTCCAGGACCTGCAGGACAGCGGCCTGCTCAGCGAGGCCGAGGCGCGGGTGCACCCGCGG
GCCAACATCGTGACCCGGGCGATTGGCGTCGAGGCCCAGCTGGAGCTGTCCCAGATTGACCTGCAGGTGCAGGACGGCGA
CACCTTCCTGCTGTGCAGCGACGGCCTGAACAAGACCGCCGAGGACTTTGAGCTGCGTGACGTGCTCAGCCACAGCGAGC
CCAATGACGTGGTGCGCAGCCTGATCCACCTGGGCCTGACCCGGGGCGCTCCGGACAACATCACCGCCATCGTGATCAAG
GCCGCAGGACACTGA