Detailed information of regulator


Summary

Regulator ID REG0073 experimental
Regulator type protein
Regulatory pathway (from literatures) Global regulator
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00006 insolico (Type i1)
Strain Escherichia coli O157:H7 str. EDL933
Replicon chromosome
Sequence Protein sequence (138 a.a.); Nucleotide sequence (414 bp)
Description The T6SS of EHEC is repressed by H-NS in an uncertian way.
Reference

External database links

Locus tag (Gene) Z2013 (hns)
Coordinates (Strand) 1829490..1829903 (-)
NCBI ID 447210122
RefSeq NC_002655
Uniprot ID A0A0E0Y0E5_ECO1C, S1PGU9_ECOLX, S1EMQ0_ECOLX, L3Q903_ECOLX, L4JBG0_ECOLX, U9YV92_ECOLX, U9YIC2_ECOLX, V0STJ3_ECOLX, U9ZPF1_ECOLX, V0VFV5_ECOLX, V0Y7Q8_ECOLX, V0ZC62_ECOLX, V0B017_ECOLX, A0A0E2L702_ECOU3, A0A080J190_ECOLX, A0A0A0F9S4_ECOLX, HNS_ECOL6, D3H2L9_ECO44, Q32GW9_SHIDS, E3PKM4_ECOH1, A7ZL10_ECO24, A0A0E1SRU9_ECOLX, Q1RCK0_ECOUT, A0A0H2YYE1_ECOK1, B1LH64_ECOSM, A0A140NCH9_ECOBD, A0A0H3PNM3_ECO5C, D6I752_ECOLX, D6J9K8_ECOLX, F4NGY0_ECOLX, E0IV23_ECOLW, A0A163Y654_KLEOX, B7UQC9_ECO27, B7MKY9_ECO45, B7LHI0_ECO55, B7N450_ECOLU, A0A0H3MG90_ECO7I, B7MU23_ECO81, A0A1S9KFY8_SHIDY, HNS_SHIFL, A0A1W2MMX0_SHIFL, A0A0H7VBX7_SHISO, A0A1X3JJB2_ECOLX, A0A1X3L589_ECOLX, F4VBR7_ECOLX, A0A1X3I9L5_ECOLX, A0A0K9T7Q1_ECOLX, F4TDD1_ECOLX, A0A1X3LIQ7_ECOLX, A0A1X3LWY5_ECOLX, A0A1X3J146_ECOLX, E9XM74_ECOLX, E6BLQ4_ECOLX, E1IMZ1_ECOLX, E1J912_ECOLX, D8E2X7_ECOLX, A0A0H3EJ00_ECO8N, A0A0E1LWR3_ECOLX, D8ACN8_ECOMS, D7XMK7_ECOLX, D7Y5Q5_ECOM1, E9TEY2_ECOLX, HNS_ECOLI, HNS_ECO57, A0A090B484_ECO57, I2WMZ9_ECOLX, A0A192CMC6_ECOLX, A0A090BZR8_ECOLX
KEGG ID ecq:ECED1_1388, ecc:c1701, elh:ETEC_1341, ecw:EcE24377A_1386, eco:b1237, ecz:ECS88_1305, ect:ECIAI39_1572, ecm:EcSMS35_1904, elw:ECW_m1329, ebd:ECBD_2385, ecj:JW1225, sfl:SF1237, ecs:ECs1739, eci:UTI89_C1434, esl:O3K_14465, ecg:E2348C_1364, eln:NRG857_06355, sdy:SDY_1289, ece:Z2013, elo:EC042_1292, ecv:APECO1_351, sft:NCTC1_01307, eck:EC55989_1332, sfx:S1323, eum:ECUMN_1536
KEGG pathway (determined by BlastKOALA) -
PDB ID 1NI8, 2MW2, 1HNS, 1HNR, 1LR1

  Target
Target Regulation (↓/↑) Target sequence
Z0264 (hcp-2) 15829487

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Histone_HNS PF00816.23 4.8e-19 33..127

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-137 MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9965 - -



  Protein sequence of regulator: 138 a.a.    .

>REG0073 NC_002655:c1829903-1829490 [Escherichia coli O157:H7 str. EDL933]
MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSLA
AVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ*

  Nucleotide sequence of regulator: 414 bp    .

>REG0073 NC_002655:c1829903-1829490 [Escherichia coli O157:H7 str. EDL933]
ATGAGCGAAGCACTTAAAATTCTGAACAACATCCGTACTCTTCGTGCGCAGGCAAGAGAATGTACACTTGAAACGCTGGA
AGAAATGCTGGAAAAATTAGAAGTTGTTGTTAACGAACGTCGCGAAGAAGAAAGCGCGGCTGCTGCTGAAGTTGAAGAGC
GCACTCGTAAACTGCAGCAATATCGCGAAATGCTGATCGCTGACGGTATTGACCCGAACGAGCTGCTGAATAGCCTTGCC
GCCGTTAAATCTGGCACCAAAGCTAAACGTGCTCAGCGTCCGGCAAAATATAGCTACGTTGACGAAAACGGCGAAACTAA
AACCTGGACTGGCCAGGGCCGTACTCCAGCTGTAATCAAAAAAGCAATGGATGAGCAAGGTAAATCCCTCGACGATTTCC
TGATCAAGCAATAA