Detailed information of regulator


Summary

Regulator ID REG0072 experimental
Regulator type protein
Regulatory pathway (from literatures) Global regulator
KEGG pathway (determined by BlastKOALA) Biofilm formation - Escherichia coli (map02026)
Related T6SS T6SS00006 insolico (Type i1)
Strain Escherichia coli O157:H7 str. EDL933
Replicon chromosome
Sequence Protein sequence (306 a.a.); Nucleotide sequence (918 bp)
Description OxyR promoted the transcription of katN in an uncertian way.
Reference

External database links

Locus tag (Gene) Z5519 (OxyR)
Coordinates (Strand) 5033893..5034810 (+)
NCBI ID 446948683
RefSeq NC_002655
Uniprot ID A0A0E0Y724_ECO1C, K4XGM7_ECOLX, S1PK88_ECOLX, S1ES85_ECOLX, L3PSX6_ECOLX, L4IUG4_ECOLX, A0A0E2KYC2_ECOU3, A0A080I908_ECOLX, A0A0A0FB35_ECOLX, OXYR_ECOL6, D3GS18_ECO44, Q32AB4_SHIDS, E3PBT8_ECOH1, A7ZUI1_ECO24, A0A0E1SYQ9_ECOLX, B1LNS1_ECOSM, A0A140NF57_ECOBD, A0A0H3PYS9_ECO5C, D6IGN7_ECOLX, E0J688_ECOLW, A0A181WY75_KLEOX, B7UNT9_ECO27, B7MI99_ECO45, B7LA63_ECO55, B7NFR1_ECOLU, A0A0H3MTH1_ECO7I, B7MR54_ECO81, A0A2S8DGF8_SHIDY, E9XV09_ECOLX, A0A0H3ESJ8_ECO8N, A0A0E1M4F2_ECOLX, I4S668_ECOLX, OXYR_ECOLI, OXYR_ECO57, I2UCE5_ECOLX, I2X035_ECOLX
KEGG ID eco:b3961, ecs:ECs4890, ece:Z5519, elw:ECW_m4318, eum:ECUMN_4492, ecc:c4922, eln:NRG857_19800, ecw:EcE24377A_4503, ecm:EcSMS35_4409, eck:EC55989_4446, sdy:SDY_3796, ecz:ECS88_4418, ect:ECIAI39_3028, elo:EC042_4336, ecg:E2348C_4275, ecj:JW3933, ebd:ECBD_4063, esl:O3K_24015, ecq:ECED1_4668, elh:ETEC_4229
KEGG pathway (determined by BlastKOALA) map02026
PDB ID 1I69, 1I6A

  Target
Target Regulation (↓/↑) Target sequence
Z1921 (KatN) 446410485

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
LysR_substrate PF03466.22 8.9e-55 89..293
HTH_1 PF00126.29 9.7e-21 3..61

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-305 MNIRDLEYLVALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELGVMLLERTSRKVLFTQAGMLLVDQARTVLREVKVLKEMASQQGETMSGPLHIGLIPTVGPYLLPHIIPMLHQTFPKLEMYLHEAQTHQLLAQLDSGKLDCVILALVKESEAFIEVPLFDEPMLLAIYEDHPWANRECVPMADLAGEKLLMLEDGHCLRDQAMGFCFEAGADEDTHFRATSLETLRNMVAAGSGITLLPALAVPPERKRDGVVYLPCIKPEPRRTIGLVYRPGSPLRSRYEQLAEAIRARMDGHFDKVLKQAV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9713 - -



  Protein sequence of regulator: 306 a.a.    .

>REG0072 NC_002655:5033893-5034810 [Escherichia coli O157:H7 str. EDL933]
MNIRDLEYLVALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELGVMLLERTSRKVLFTQAGMLLVDQARTVLREVKVLKE
MASQQGETMSGPLHIGLIPTVGPYLLPHIIPMLHQTFPKLEMYLHEAQTHQLLAQLDSGKLDCVILALVKESEAFIEVPL
FDEPMLLAIYEDHPWANRECVPMADLAGEKLLMLEDGHCLRDQAMGFCFEAGADEDTHFRATSLETLRNMVAAGSGITLL
PALAVPPERKRDGVVYLPCIKPEPRRTIGLVYRPGSPLRSRYEQLAEAIRARMDGHFDKVLKQAV*

  Nucleotide sequence of regulator: 918 bp    .

>REG0072 NC_002655:5033893-5034810 [Escherichia coli O157:H7 str. EDL933]
ATGAATATTCGTGATCTTGAGTACCTGGTGGCATTGGCTGAACACCGCCATTTTCGGCGTGCGGCAGATTCCTGCCACGT
TAGCCAGCCGACGCTTAGCGGGCAAATTCGTAAGCTGGAAGATGAGCTGGGCGTGATGTTGCTGGAGCGGACCAGCCGTA
AAGTGTTGTTCACCCAGGCGGGAATGCTGCTGGTGGATCAGGCGCGTACCGTGCTGCGTGAGGTGAAAGTCCTTAAAGAG
ATGGCAAGCCAGCAGGGCGAGACGATGTCCGGACCGCTGCATATTGGTTTGATTCCCACGGTTGGACCGTACCTGCTACC
GCATATTATCCCGATGCTGCACCAGACCTTTCCAAAGCTGGAAATGTATCTGCATGAAGCACAGACCCACCAGTTACTGG
CGCAACTGGACAGCGGCAAACTCGATTGCGTGATCCTCGCGCTGGTGAAAGAGAGCGAAGCATTCATTGAAGTGCCGTTG
TTTGATGAGCCAATGTTGCTGGCTATCTATGAAGACCACCCGTGGGCGAACCGCGAATGCGTACCGATGGCCGATCTGGC
AGGGGAAAAACTGCTGATGCTGGAAGATGGTCACTGTTTGCGCGATCAGGCAATGGGTTTTTGCTTTGAAGCCGGGGCGG
ATGAAGATACACACTTCCGCGCGACCAGCCTGGAGACGCTGCGCAACATGGTGGCGGCAGGTAGCGGGATCACTTTACTG
CCAGCGCTGGCTGTGCCGCCGGAGCGCAAACGCGATGGGGTTGTTTATCTGCCGTGCATTAAGCCGGAACCACGCCGCAC
TATTGGCCTGGTTTATCGTCCTGGCTCACCGCTGCGCAGCCGCTATGAGCAGCTGGCAGAGGCCATCCGCGCAAGAATGG
ATGGCCATTTCGATAAAGTGTTAAAACAGGCGGTTTAA