SecReT6, T6SS database

Detailed information of regulator

Summary

Regulator ID	REG0041
Regulator type	protein
Regulatory pathway (from literatures)	RsmA regulatory pathway
KEGG pathway (determined by BlastKOALA)	Two-component system (map02020); Biofilm formation - Vibrio cholerae (map05111); Biofilm formation - Pseudomonas aeruginosa (map02025); Biofilm formation - Escherichia coli (map02026)
Related T6SS	T6SS00003 (Type i3)
Strain	Pseudomonas aeruginosa PAO1
Replicon	chromosome
Sequence	Protein sequence (72 a.a.); Nucleotide sequence (216 bp)
Description	RsmN negative regulates H1-T6SS in P.aeruginosa PAO1 through binding a motif (AAGGA) in a stem-loop structure overlapping with the ribosome bind site (RBS) in fhA1 mRNA.; Deletion of rsmA enables PldA secretion in a H2-T6SS–dependent way.
Reference	[1] Romero M, Silistre H, Lovelock L, et al. Genome-wide mapping of the RNA targets of the Pseudomonas aeruginosa riboregulatory protein RsmN. Nucleic Acids Res. 2018 Jul 27;46(13):6823-6840. doi: 10.1093/nar/gky324. PMID: 29718466 [2] Allsopp LP, Wood TE, Howard SA, et al. RsmA and AmrZ orchestrate the assembly of all three type VI secretion systems in Pseudomonas aeruginosa. Proc Natl Acad Sci U S A. 2017 Jul 18;114(29):7707-7712. doi: 10.1073/pnas.1700286114. Epub 2017 Jul 3. PMID: 28673999

External database links

Locus tag (Gene)	PA5183a (RsmN)
Coordinates (Strand)	5836470..5836685 (-)
NCBI ID	554753081
RefSeq	NC_002516
Uniprot ID	UPI0000397010
KEGG ID	-
KEGG pathway (determined by BlastKOALA)	map02020; map05111; map02025; map02026
PDB ID	-

Target

Target	Regulation (↓/↑)	Target sequence
FHA (PA0081)	↑	gtgcagtggcggctggagaccaggcgctccgggtccggcaggacccagtcgttgtccgggccccgaccgatggtcagctgtccctggtccagtaccttttccgaacactgaccgggggtcagcttgtggtagctggtgatggtcaatcgcagcggcattgctactccttgcattgccagcgcccggctcttccaggcgctcacccccgtgcccgagggatttcggttcgcatccaggctggcccgacggctttccggcgtttcgtcgcctcgggaagacacatcgggt
PA3487 (pldA) expression	↑	-

Pfam domain hit(s) of regulator

Domain	Pfam ID	E-value	Aligned region
CsrA	PF02599.18	2.1e-10	4..67

Transmembrane helices

Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction	Region	Sequence
Outside	1-71	MGFLILSRREGEGITLSLKADYPAEELIRQLREGGIRILVTDIIGNQARVGIEAPRGVLIVRDELKTAPKG

Signal peptides

Signal peptides and corresponding cleavage sites are predicted using SignalP 5.0 software.

Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).

Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).

Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).

Prediction	Probability	Cleavage site	Signal peptide sequence
Other	0.9900	-	-

Protein sequence of regulator: 72 a.a. .

                                    >REG0041 NC_002516:c5836685-5836470 [Pseudomonas aeruginosa PAO1]
MGFLILSRREGEGITLSLKADYPAEELIRQLREGGIRILVTDIIGNQARVGIEAPRGVLIVRDELKTAPKG*

Nucleotide sequence of regulator: 216 bp .

                                    >REG0041 NC_002516:c5836685-5836470 [Pseudomonas aeruginosa PAO1]
ATGGGTTTCCTGATACTCTCCCGCCGAGAAGGCGAAGGCATCACCCTGTCCCTCAAGGCCGACTACCCGGCGGAGGAACT
GATTCGGCAATTGCGCGAAGGCGGCATCCGGATCCTGGTCACCGATATCATCGGCAACCAGGCCCGGGTCGGGATCGAGG
CGCCGCGTGGCGTCCTGATCGTTCGCGACGAGTTGAAAACGGCACCGAAAGGCTGA

                                