Detailed information of regulator


Summary

Regulator ID REG0039 experimental
Regulator type protein
Regulatory pathway (from literatures) Global regulator
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00002 experimental (Type i1)
Strain Vibrio cholerae O1 biovar El Tor str. N16961
Replicon chromosome
Sequence Protein sequence (531 a.a.); Nucleotide sequence (1593 bp)
Description Complementation of the vasH-null mutation in an N16961 background restored Hcp synthesis but not secretion.
Reference

External database links

Locus tag (Gene) VC_RS13930 (VasH)
Coordinates (Strand) 128790..130382 (+)
NCBI ID 446006938
RefSeq NC_002506
Uniprot ID VASH_VIBCH, A0A0X1L1T0_VIBCO, A0A0H3AFG8_VIBC3, A0A0K9UVH8_VIBCL, A0A0H3QAP0_VIBCL, C3LUE1_VIBCM, A0A023PRF8_VIBCL
KEGG ID vcm:VCM66_A0115, vcq:EN18_04310, vcx:VAA049_1791, vco:VC0395_0020, vch:VC_A0117
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
VCA0017 (hcp-2) transcript -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Sigma54_activat PF00158.28 1.5e-68 193..359
HTH_8 PF02954.21 1.8e-06 486..521

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-530 MSQWLAFATQLVGVRKSHQLALQFVDLLTQGLDLSDSLLLLPSSDGRLLVPHDPQRQFAWSVTDFDVPFAHVLQSSNAMHLTAEELVFWQSNRTFSQLTSRVGMFDSVWIQPLPMDTRQVHSILLLMGESHGIVSAFENADFLKFIEVFSQQWSLLNDMEREEQRRLELKQSLTDIERDSAQRSLANALSRTLIGESAAMQKLREQIVSAANSQLSVMVQGETGTGKELVAAAVHELSSRKSAPFVAINCAAIPEHLLESELFGYCKGAFSGADSDKQGLIAQANGGTLFLDEIGDMPLTLQAKLLRVLESRTFRPLGGKQELSSDFRLVSATHVNLLDQVRKKEFRQDLYYRLFQYPITLPRLAARLEDIELLSEHFVRVFNLQHNTRIRGLNYRAIDCLKQYDFPGNVRELKHLIEFGCAQTADGTQVEASCFAHRLQTLPCLAPEATPVAVSVETENVDLEPSVALAGEPNFAVIHDLKQAVSQFEALIISERLNRFAGDRAKAAKSLGIPKRTLAYKCLKLEIKTP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9730 - -



  Protein sequence of regulator: 531 a.a.    .

>REG0039 NC_002506:128790-130382 [Vibrio cholerae O1 biovar El Tor str. N16961]
MSQWLAFATQLVGVRKSHQLALQFVDLLTQGLDLSDSLLLLPSSDGRLLVPHDPQRQFAWSVTDFDVPFAHVLQSSNAMH
LTAEELVFWQSNRTFSQLTSRVGMFDSVWIQPLPMDTRQVHSILLLMGESHGIVSAFENADFLKFIEVFSQQWSLLNDME
REEQRRLELKQSLTDIERDSAQRSLANALSRTLIGESAAMQKLREQIVSAANSQLSVMVQGETGTGKELVAAAVHELSSR
KSAPFVAINCAAIPEHLLESELFGYCKGAFSGADSDKQGLIAQANGGTLFLDEIGDMPLTLQAKLLRVLESRTFRPLGGK
QELSSDFRLVSATHVNLLDQVRKKEFRQDLYYRLFQYPITLPRLAARLEDIELLSEHFVRVFNLQHNTRIRGLNYRAIDC
LKQYDFPGNVRELKHLIEFGCAQTADGTQVEASCFAHRLQTLPCLAPEATPVAVSVETENVDLEPSVALAGEPNFAVIHD
LKQAVSQFEALIISERLNRFAGDRAKAAKSLGIPKRTLAYKCLKLEIKTP*

  Nucleotide sequence of regulator: 1593 bp    .

>REG0039 NC_002506:128790-130382 [Vibrio cholerae O1 biovar El Tor str. N16961]
ATGAGTCAATGGCTGGCGTTTGCAACCCAATTGGTGGGAGTAAGGAAGTCCCACCAGCTTGCGCTGCAATTTGTTGATCT
GCTGACTCAAGGCTTAGATCTGAGTGATAGCCTTTTGTTGTTGCCATCGTCGGATGGGCGTTTACTTGTGCCTCATGATC
CACAGCGTCAGTTCGCGTGGTCAGTGACGGATTTTGATGTGCCTTTTGCCCATGTTTTGCAGTCATCCAATGCGATGCAT
TTGACCGCGGAAGAGTTGGTATTTTGGCAATCCAATCGCACTTTTAGCCAGTTAACCTCTCGCGTGGGGATGTTTGATTC
GGTATGGATCCAACCCCTGCCGATGGATACTCGTCAAGTACACTCGATCTTGCTGTTGATGGGCGAGAGTCACGGTATCG
TGAGCGCTTTTGAAAACGCGGACTTTTTGAAGTTTATCGAGGTTTTTTCCCAGCAATGGTCACTGCTCAACGATATGGAA
CGTGAAGAGCAGCGCCGCTTGGAGCTGAAACAATCGCTGACGGATATTGAACGCGACTCGGCGCAGCGCTCACTGGCCAA
TGCGTTATCGCGTACTTTGATTGGTGAAAGCGCTGCGATGCAAAAGCTGCGTGAGCAGATTGTCTCTGCCGCTAACTCTC
AGCTCTCGGTCATGGTGCAAGGTGAAACTGGCACGGGGAAAGAGTTAGTCGCCGCGGCCGTGCATGAACTTTCGTCACGT
AAGTCTGCGCCGTTTGTTGCGATCAACTGTGCGGCGATCCCTGAGCATCTACTGGAAAGTGAACTGTTTGGTTACTGCAA
AGGGGCATTTTCTGGAGCGGACAGCGATAAACAGGGACTTATCGCACAAGCGAATGGTGGCACGCTATTTCTGGATGAGA
TCGGCGATATGCCGCTCACCTTACAAGCCAAATTATTGCGTGTGCTTGAATCGCGTACTTTTCGACCGCTCGGTGGTAAG
CAGGAGCTCAGTTCCGATTTCCGTCTGGTATCTGCCACACACGTCAATCTGCTGGATCAAGTACGCAAAAAAGAATTTCG
CCAAGATCTCTATTACCGTCTATTCCAGTATCCGATCACCTTGCCGCGTTTGGCGGCACGCTTGGAAGATATTGAGCTGC
TCAGTGAGCACTTTGTGCGCGTGTTCAACTTGCAACATAACACGCGCATTCGTGGTTTGAACTATCGAGCCATCGACTGC
CTTAAGCAGTACGACTTCCCGGGAAATGTGCGTGAGCTGAAACATTTGATTGAGTTTGGCTGCGCGCAAACAGCGGATGG
TACGCAGGTGGAAGCTAGTTGCTTTGCCCATCGTTTACAAACCCTACCCTGTCTTGCGCCTGAAGCGACGCCGGTAGCCG
TTTCTGTCGAAACTGAGAACGTGGATCTTGAACCCTCGGTTGCGCTGGCTGGAGAACCGAATTTTGCGGTTATCCATGAT
TTGAAACAGGCGGTCAGTCAGTTTGAAGCGTTGATCATCAGTGAGCGTTTGAACCGCTTTGCTGGCGATCGCGCGAAAGC
GGCGAAAAGTCTCGGTATCCCTAAGCGTACCTTGGCCTACAAGTGCCTGAAATTGGAGATCAAAACCCCATGA