Detailed information of immunity protein


Summary

Immunity protein ID IMU00343 experimental
Cognate effector EFF01452 experimental
Related T6SS (Type) T6SS00006 insolico (Type i1)
Strain Escherichia coli O157:H7 str. EDL933
Replicon chromosome
Sequence Protein sequence (281 a.a.); Nucleotide sequence (843 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) Z5015 (CTI5)
Coordinates (Strand) 4576267..4577109 (+)
NCBI ID 445994995
RefSeq NC_002655
Uniprot ID A0A0E0XU06_ECO1C, S1E8B6_ECOLX, A7ZTE3_ECO24, A0A140N4S5_ECOBD, A0A1X3JAX6_ECOLX, E1J534_ECOLX, A0A0E1M301_ECOLX, D7XWS7_ECOLX, YIBA_ECOLI, I2UCK3_ECOLX
KEGG ID ecw:EcE24377A_4093, eco:b3594, esl:O3K_00870, ecj:JW3568, ebd:ECBD_0136
PDB ID 1OYZ

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
HEAT_2 PF13646.8 1.6e-08 171..235

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-280 MSNTYQKRKASKEYGLYNQCKKLNDDELFRLLDDHNSLKRISSARVLQLRGGQDAVRLAIEFCSDKNYIRRDIGAFILGQIKICKKCEDNVFNILNNMALNDKSACVRATAIESTAQRCKKNPIYSPKIVEQSQITAFDKSTNVRRATAFAISVINDKATIPLLINLLKDPNGDVRNWAAFAININKYDNSDIRDCFVEMLQDKNEEVRIEAIIGLSYRKDKRVLSVLCDELKKNTVYDDIIEAAGELGDKTLLPVLDTMLYKFDDNEIITSAIDKLKRS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9940 - -



  Protein sequence: 281 a.a.    .

>IMU00343 NC_002655:4576267-4577109 [Escherichia coli O157:H7 str. EDL933]
MSNTYQKRKASKEYGLYNQCKKLNDDELFRLLDDHNSLKRISSARVLQLRGGQDAVRLAIEFCSDKNYIRRDIGAFILGQ
IKICKKCEDNVFNILNNMALNDKSACVRATAIESTAQRCKKNPIYSPKIVEQSQITAFDKSTNVRRATAFAISVINDKAT
IPLLINLLKDPNGDVRNWAAFAININKYDNSDIRDCFVEMLQDKNEEVRIEAIIGLSYRKDKRVLSVLCDELKKNTVYDD
IIEAAGELGDKTLLPVLDTMLYKFDDNEIITSAIDKLKRS*

  Nucleotide sequence: 843 bp    .

>IMU00343 NC_002655:4576267-4577109 [Escherichia coli O157:H7 str. EDL933]
ATGTCAAATACATACCAGAAAAGAAAGGCAAGTAAAGAGTATGGTTTATATAATCAATGTAAGAAACTAAATGATGATGA
ATTATTTCGCTTACTTGATGATCACAATTCCTTGAAAAGGATTTCATCTGCCAGAGTATTACAGTTAAGAGGTGGGCAAG
ACGCTGTTAGATTGGCAATTGAGTTCTGCTCTGATAAAAATTATATCCGTAGAGATATCGGAGCATTTATACTCGGGCAA
ATAAAAATTTGCAAAAAATGCGAAGATAATGTTTTTAATATTTTGAACAATATGGCATTGAATGATAAGAGCGCTTGCGT
TCGAGCTACGGCAATCGAGTCAACGGCTCAGCGATGCAAGAAAAACCCAATTTATTCACCTAAAATAGTAGAACAATCTC
AAATTACTGCTTTTGATAAATCGACTAATGTCAGACGTGCTACAGCATTTGCTATTTCTGTTATCAATGATAAAGCAACA
ATTCCACTATTGATTAATCTGTTAAAAGATCCAAATGGAGATGTCAGAAACTGGGCCGCATTTGCAATAAATATCAATAA
ATATGATAATAGTGATATTAGGGATTGTTTTGTGGAGATGCTTCAGGATAAAAATGAGGAAGTCCGTATTGAAGCAATAA
TCGGACTTTCCTACAGAAAAGATAAAAGGGTTTTATCTGTTTTATGCGATGAGTTAAAAAAAAATACTGTTTATGATGAT
ATCATTGAAGCTGCGGGTGAATTAGGTGATAAAACGCTACTTCCTGTTTTAGATACTATGTTGTACAAGTTTGATGACAA
TGAAATTATAACTTCCGCTATTGATAAGCTGAAGCGTTCATAG