Detailed information of immunity protein


Summary

Immunity protein ID IMU00307 experimental
Cognate effector EFF01486 experimental
Related T6SS (Type) T6SS00312 experimental (Type i4b)
Strain Acinetobacter baumannii AB307-0294
Replicon chromosome
Sequence Protein sequence (448 a.a.); Nucleotide sequence (1344 bp)
Description Coproduction of the PelB-LysM fusion protein with the predicted cognate immunity protein LysMI resulted in no observable lysis of the cell culture, but WT levels of growth were not restored.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ABBFA_00118 (LysMI)
Coordinates (Strand) 136278..137621 (-)
NCBI ID 447062379
RefSeq NZ_CP001172
Uniprot ID A0A0D5YCB0_ACIBA, A0A0J0ZLM9_ACIBA, B0V9T4_ACIBY
KEGG ID aby:ABAYE0124
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
PGAP1 PF07819.15 2.1e-33 152..374

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-447 MPSLTPLHETYCKWDRTPPSQADVLEGLAQLFSTSLNGVHELIQVINIEVLKNAFGISAQNAKNFQKRPSVQKAYQFSYGALQKYGSCFLAPGLRRIIEKFPTLHEKPLTPTLHFLVGVLNGIFGDYLLKQHSPLALPMVLYDHYGAIQQGELAGRIVILVHGLCMNHLTWSNAHYGGIGERLLAQRDHNTMLYLNYNTGRRISANGRSFSNLLEDLVQRNPRITSIDLIGHSMGGLVSRSALFYGKQNMYQWIHMVENLVCIGSPHHGAVLERFGFALQDRLGAFPFVGLIGQLVNIRSNGILDLRHGSVRDDDWEYMDARIGMMDDNRAPAPLPSHINTFLVAGTLEFEKVRNKALTVIGDYLVSVKSALGEHPNPRFQLKVPDSHKAVFYGLNHFEIQYHSSVAEQITRWLYPHVNDYVQDGIQTHIIDMPNYSLEDLEGIVET



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9888 - -



  Protein sequence: 448 a.a.    .

>IMU00307 NZ_CP001172:c137621-136278 [Acinetobacter baumannii AB307-0294]
MPSLTPLHETYCKWDRTPPSQADVLEGLAQLFSTSLNGVHELIQVINIEVLKNAFGISAQNAKNFQKRPSVQKAYQFSYG
ALQKYGSCFLAPGLRRIIEKFPTLHEKPLTPTLHFLVGVLNGIFGDYLLKQHSPLALPMVLYDHYGAIQQGELAGRIVIL
VHGLCMNHLTWSNAHYGGIGERLLAQRDHNTMLYLNYNTGRRISANGRSFSNLLEDLVQRNPRITSIDLIGHSMGGLVSR
SALFYGKQNMYQWIHMVENLVCIGSPHHGAVLERFGFALQDRLGAFPFVGLIGQLVNIRSNGILDLRHGSVRDDDWEYMD
ARIGMMDDNRAPAPLPSHINTFLVAGTLEFEKVRNKALTVIGDYLVSVKSALGEHPNPRFQLKVPDSHKAVFYGLNHFEI
QYHSSVAEQITRWLYPHVNDYVQDGIQTHIIDMPNYSLEDLEGIVET*

  Nucleotide sequence: 1344 bp    .

>IMU00307 NZ_CP001172:c137621-136278 [Acinetobacter baumannii AB307-0294]
ATGCCGAGCTTAACACCGTTACATGAAACTTATTGTAAATGGGATCGTACGCCACCTAGTCAGGCCGACGTACTAGAAGG
TTTAGCTCAACTGTTCAGTACCAGCTTAAATGGTGTACATGAATTAATACAAGTCATTAATATTGAAGTATTAAAAAATG
CTTTTGGTATTAGCGCCCAAAATGCTAAAAATTTCCAAAAACGGCCTTCTGTCCAAAAGGCATATCAGTTTTCTTATGGT
GCCTTACAAAAATATGGTAGTTGTTTTTTAGCACCAGGGTTACGTCGTATTATTGAAAAATTTCCAACCCTTCATGAGAA
GCCATTAACGCCAACCCTTCATTTTTTAGTAGGAGTGTTAAATGGTATTTTCGGAGACTATCTACTTAAACAACATAGTC
CCCTCGCCTTGCCAATGGTTCTATACGACCACTACGGTGCAATCCAACAAGGCGAACTTGCAGGCCGTATTGTAATTTTG
GTTCATGGTTTGTGCATGAACCATCTTACTTGGTCAAATGCACATTATGGCGGGATTGGTGAGCGTCTGTTAGCGCAGCG
TGATCACAACACGATGCTGTATTTAAATTACAACACAGGACGCCGTATTTCAGCCAATGGTCGCAGTTTCTCAAATTTAT
TAGAAGATTTAGTACAGCGTAATCCAAGAATTACTAGCATTGATTTAATTGGTCATAGTATGGGTGGACTGGTTTCCCGT
AGCGCACTGTTTTACGGTAAACAAAATATGTACCAATGGATTCATATGGTCGAAAACCTCGTCTGTATTGGATCTCCCCA
CCACGGTGCAGTACTTGAGCGTTTTGGATTTGCGTTACAAGATCGGCTAGGCGCTTTTCCATTTGTTGGCCTAATTGGTC
AGTTGGTTAACATCCGTAGTAATGGGATTTTAGACCTACGCCATGGTAGTGTTCGAGATGATGACTGGGAATACATGGAT
GCCCGTATTGGTATGATGGATGACAACCGTGCTCCGGCTCCTCTACCTTCCCATATCAATACCTTTTTAGTGGCAGGAAC
ACTCGAGTTTGAAAAGGTGCGTAATAAAGCGCTTACCGTGATTGGCGATTACTTAGTGAGTGTAAAAAGCGCACTAGGTG
AACATCCTAATCCACGTTTTCAGCTTAAAGTTCCAGACTCACATAAAGCGGTGTTTTATGGCTTAAATCACTTTGAAATT
CAGTATCACTCAAGTGTTGCCGAACAGATTACTCGCTGGTTATATCCTCATGTGAATGATTATGTGCAAGACGGTATTCA
AACCCATATTATTGATATGCCGAACTATTCGCTCGAAGATTTAGAAGGAATTGTAGAGACGTAA