Detailed information of immunity protein


Summary

Immunity protein ID IMU00166 experimental
Cognate effector EFF00003 experimental
Related T6SS (Type) T6SS00002 experimental (Type i1)
Strain Vibrio cholerae O1 biovar El Tor str. N16961
Replicon chromosome
Sequence Protein sequence (243 a.a.); Nucleotide sequence (729 bp)
Description TsiV2
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VCA0021 (TsiV2)
Coordinates (Strand) 26653..27381 (+)
NCBI ID 15600792
RefSeq NC_002506
Uniprot ID TSIV2_VIBCH
KEGG ID vch:VC_A0021
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-38 MLIDKNELEQLKVKLHSSEVIYQWDSVAYGERRSEIFR
Transmembrane helix 39-61 VFGAISAGIVPLWPFIFFADIQF
Outside 62-65 NSKE
Transmembrane helix 66-85 FWGFICFSLAGMAAARYLFM
Inside 86-116 PDHRYCYSLTQAGIYYTDQEVIPDAAYTFVR
Transmembrane helix 117-139 GFAWVGIAVCLLALAVVGPLAFV
Outside 140-242 GAGGFALLAFGLTNFHPTVHKKEVYFADQLIVFDPIKEKMVDLNTDSTDEPWFDRRLFFSSLDEKTHFIELVKSIHNNVDYLPLQRVNDQYKHPIFNQELKEE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9583 - -



  Protein sequence: 243 a.a.    .

>IMU00166 NC_002506:26653-27381 [Vibrio cholerae O1 biovar El Tor str. N16961]
MLIDKNELEQLKVKLHSSEVIYQWDSVAYGERRSEIFRVFGAISAGIVPLWPFIFFADIQFNSKEFWGFICFSLAGMAAA
RYLFMPDHRYCYSLTQAGIYYTDQEVIPDAAYTFVRGFAWVGIAVCLLALAVVGPLAFVGAGGFALLAFGLTNFHPTVHK
KEVYFADQLIVFDPIKEKMVDLNTDSTDEPWFDRRLFFSSLDEKTHFIELVKSIHNNVDYLPLQRVNDQYKHPIFNQELK
EE*

  Nucleotide sequence: 729 bp    .

>IMU00166 NC_002506:26653-27381 [Vibrio cholerae O1 biovar El Tor str. N16961]
ATGTTAATTGATAAAAATGAGTTAGAGCAGTTAAAGGTAAAATTACACAGCAGTGAGGTTATTTATCAATGGGATAGTGT
GGCTTACGGAGAGAGAAGATCTGAAATATTTCGCGTTTTTGGGGCAATCTCTGCTGGTATTGTTCCCCTTTGGCCATTTA
TTTTTTTTGCAGATATTCAATTTAATAGTAAAGAGTTTTGGGGATTTATCTGCTTTAGTCTGGCGGGCATGGCTGCTGCC
AGATATCTTTTTATGCCCGACCACCGTTATTGCTACAGTTTAACGCAAGCGGGGATTTATTATACGGATCAAGAAGTGAT
CCCAGATGCGGCCTACACTTTTGTGCGTGGTTTTGCTTGGGTGGGGATTGCGGTCTGTTTGTTAGCCTTAGCCGTCGTTG
GCCCGTTAGCGTTTGTCGGTGCGGGCGGTTTTGCCCTGCTGGCCTTTGGTTTGACCAACTTCCACCCCACCGTACATAAG
AAAGAGGTTTACTTTGCTGACCAATTGATTGTTTTTGATCCCATCAAAGAAAAGATGGTGGATTTAAATACAGATAGCAC
AGATGAACCATGGTTTGACAGACGGCTATTTTTTAGTTCACTTGATGAGAAGACGCATTTTATTGAGCTCGTGAAGAGTA
TTCATAATAATGTCGACTATCTTCCGTTACAGCGAGTTAACGATCAGTACAAGCATCCAATCTTTAATCAAGAATTAAAA
GAGGAATAG