Detailed information of effector


Summary

Effector ID EFF76653 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS17510 experimental (Type Unknown)
Strain Burkholderia glumae BGR1
Replicon chromosome
Sequence Protein sequence (186 a.a.); Nucleotide sequence (558 bp)
Description In the presence of E. coli as prey, the relative gene expression level of only tssD1 was increased whereas the relative gene expression levels of the tssD2, tssD4, and tssD5 genes showed little difference regardless of the presence of prey
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BGLU_RS23285
Coordinates (Strand) 897718..898275 (-)
NCBI ID WP_012733560.1
RefSeq NC_012721
Uniprot ID A0A2J9HIZ3_BURGL, C5AMW5_BURGB
KEGG ID bgl:bglu_2g07470
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 1.1e-17 36..152

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-185 MDLILFQPGDQSIMNSDGSEIDNSGWTADGPSGLCIEIVSLHQGMKQQVTTDVSNNARTSGRPIITEFTLVKYVDQTSVKLYEYCLGAKLLGSGAGAPSTIYIARESGGKTMNIIKIQLKDALISEIQLQTHPNDMPTEQFKLNFTEVIWTYTQQLNNMTAKGVKTAGWSLAKNMPIGGSFSGLV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9865 - -



  Protein sequence: 186 a.a.    .

>EFF76653 NC_012721:c898275-897718 [Burkholderia glumae BGR1]
MDLILFQPGDQSIMNSDGSEIDNSGWTADGPSGLCIEIVSLHQGMKQQVTTDVSNNARTSGRPIITEFTLVKYVDQTSVK
LYEYCLGAKLLGSGAGAPSTIYIARESGGKTMNIIKIQLKDALISEIQLQTHPNDMPTEQFKLNFTEVIWTYTQQLNNMT
AKGVKTAGWSLAKNMPIGGSFSGLV*

  Nucleotide sequence: 558 bp    .

>EFF76653 NC_012721:c898275-897718 [Burkholderia glumae BGR1]
ATGGATCTGATTCTCTTCCAGCCGGGCGATCAAAGCATCATGAACAGCGACGGCAGCGAGATCGACAACTCGGGCTGGAC
GGCCGACGGCCCGTCGGGCCTGTGCATCGAAATCGTGTCGCTGCACCAGGGCATGAAGCAGCAGGTCACCACCGACGTCA
GCAACAACGCGCGGACCTCGGGCCGGCCCATCATCACCGAGTTCACGCTGGTCAAGTACGTGGACCAGACCTCGGTGAAG
CTCTACGAGTACTGCCTCGGCGCCAAGCTGCTGGGCAGCGGCGCGGGCGCGCCGAGCACCATCTACATCGCCCGCGAGTC
GGGCGGCAAGACGATGAACATCATCAAGATCCAGCTGAAGGACGCCCTGATCAGCGAGATCCAGCTGCAGACGCACCCGA
ACGACATGCCCACCGAGCAGTTCAAGCTCAACTTCACCGAAGTCATCTGGACCTACACGCAGCAGCTCAACAACATGACT
GCCAAGGGGGTCAAGACGGCCGGCTGGAGTCTCGCCAAGAACATGCCGATCGGCGGCAGCTTCTCGGGGCTCGTCTGA