Detailed information of effector


Summary

Effector ID EFF76652 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS17508 experimental (Type i3)
Strain Burkholderia glumae BGR1
Replicon chromosome
Sequence Protein sequence (161 a.a.); Nucleotide sequence (483 bp)
Description In the presence of E. coli as prey, the relative gene expression level of only tssD1 was increased whereas the relative gene expression levels of the tssD2, tssD4, and tssD5 genes showed little difference regardless of the presence of prey
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BGLU_RS18660
Coordinates (Strand) 159409..159891 (+)
NCBI ID WP_012733029.1
RefSeq NC_012721
Uniprot ID A0A2J9HKI2_BURGL, C5ALD1_BURGB
KEGG ID bgl:bglu_2g01440
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 2.2e-40 6..136

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-160 MAQDIFLKLNGIDGESEDASHKNEIDVLSWSWNVSQQSNMHVGSGGGAGRATVDDLTFEHFIDRSTPNLTQYCLTGKHIDEARLVVRKAGGNPLEYLKLTMNDVLVTSVHPSGVSESESRPREVVSLSFSRMKQEYVVQNAQGGSGGAITATFDIKKNSA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9818 - -



  Protein sequence: 161 a.a.    .

>EFF76652 NC_012721:159409-159891 [Burkholderia glumae BGR1]
MAQDIFLKLNGIDGESEDASHKNEIDVLSWSWNVSQQSNMHVGSGGGAGRATVDDLTFEHFIDRSTPNLTQYCLTGKHID
EARLVVRKAGGNPLEYLKLTMNDVLVTSVHPSGVSESESRPREVVSLSFSRMKQEYVVQNAQGGSGGAITATFDIKKNSA
*

  Nucleotide sequence: 483 bp    .

>EFF76652 NC_012721:159409-159891 [Burkholderia glumae BGR1]
ATGGCACAAGACATCTTTCTCAAACTCAACGGGATCGATGGTGAGTCGGAGGACGCCAGCCACAAGAATGAAATCGACGT
TCTTAGCTGGTCGTGGAATGTCTCGCAGCAGTCGAACATGCACGTCGGTTCCGGAGGCGGTGCGGGTCGGGCGACCGTTG
ACGACCTCACCTTCGAGCACTTCATCGACCGTTCGACGCCGAACCTCACGCAGTACTGCCTGACGGGCAAGCACATCGAC
GAGGCCAGGCTCGTCGTGCGCAAGGCAGGCGGCAACCCGCTCGAATACCTCAAGCTGACCATGAACGACGTGCTGGTCAC
TTCGGTGCACCCGTCTGGCGTGAGCGAAAGCGAATCGCGACCGCGTGAAGTGGTGTCGCTTTCGTTCTCGCGCATGAAGC
AGGAGTACGTCGTGCAGAATGCGCAAGGCGGCAGCGGCGGGGCGATCACGGCCACCTTCGACATCAAGAAGAACAGCGCC
TGA