Detailed information of effector


Summary

Effector ID EFF76649 experimental
Effector type Tie
Cognate immunity protein -
Related T6SS (Type) T6SS00260 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (49 a.a.); Nucleotide sequence (147 bp)
Description TssS is a Mn2+-chelating protein and that its Mn2+-chelating ability is essential for the disruption of host innate immunity. TssS counteracted the cytoplasmic Mn2+ increase to inhibit the STING-mediated innate immune response by sequesteing Mn2+. TssS-mediated STING inhibition sabotaged bacterial clearance in vivo.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) YPK_3548 (TssS)
Coordinates (Strand) 3905041..3905187 (-)
NCBI ID -
RefSeq NC_010465
Uniprot ID -
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-48 MYLRRLYDLPVLSVAGTLSITSDIFIDAKERLYFKELLMCYHHQPDSI



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.6815 - -



  Protein sequence: 49 a.a.    .

>EFF76649 NC_010465:c3905187-3905041 [Yersinia pseudotuberculosis YPIII]
MYLRRLYDLPVLSVAGTLSITSDIFIDAKERLYFKELLMCYHHQPDSI*

  Nucleotide sequence: 147 bp    .

>EFF76649 NC_010465:c3905187-3905041 [Yersinia pseudotuberculosis YPIII]
ATGTATTTACGGCGTCTTTACGATCTGCCTGTTCTCTCCGTCGCGGGCACTTTGTCAATAACCTCGGATATTTTCATTGA
TGCCAAAGAACGACTTTATTTCAAAGAACTACTGATGTGTTACCACCACCAGCCGGATAGCATCTAA