Detailed information of effector
Summary
| Effector ID | EFF76649  |
| Effector type | Tie |
| Cognate immunity protein | - |
| Related T6SS (Type) | T6SS00260 (Type i3) |
| Strain | Yersinia pseudotuberculosis YPIII |
| Replicon | chromosome |
| Sequence | Protein sequence (49 a.a.); Nucleotide sequence (147 bp) |
| Description | TssS is a Mn2+-chelating protein and that its Mn2+-chelating ability is essential for the disruption of host innate immunity. TssS counteracted the cytoplasmic Mn2+ increase to inhibit the STING-mediated innate immune response by sequesteing Mn2+. TssS-mediated STING inhibition sabotaged bacterial clearance in vivo. |
| Reference |
Experimental investigation has been performed.
Bioinformatics investigation has been performedExternal database links
| Locus tag (Gene) | YPK_3548 (TssS) |
| Coordinates (Strand) | 3905041..3905187 (-) |
| NCBI ID | - |
| RefSeq | NC_010465 |
| Uniprot ID | - |
| KEGG ID | - |
| PDB ID | - |
Pfam domain hit(s)
| Domain | Pfam ID | E-value | Aligned region |
|---|
Transmembrane helices
- Transmembrane helices are predicted using TMHMM 2.0 software.
| Prediction | Region | Sequence |
|---|---|---|
| Outside | 1-48 | MYLRRLYDLPVLSVAGTLSITSDIFIDAKERLYFKELLMCYHHQPDSI |
Signal peptides
- Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
- Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
- Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
| Prediction | Probability | Cleavage site | Signal peptide sequence |
|---|---|---|---|
| Other | 0.6815 | - | - |
Protein sequence: 49 a.a. .
>EFF76649 NC_010465:c3905187-3905041 Type VI Metal Ion acquisition Effector (Tie) [Yersinia pseudotuberculosis YPIII]
MYLRRLYDLPVLSVAGTLSITSDIFIDAKERLYFKELLMCYHHQPDSI*
MYLRRLYDLPVLSVAGTLSITSDIFIDAKERLYFKELLMCYHHQPDSI*
Nucleotide sequence: 147 bp .
>EFF76649 NC_010465:c3905187-3905041 Type VI Metal Ion acquisition Effector (Tie) [Yersinia pseudotuberculosis YPIII]
ATGTATTTACGGCGTCTTTACGATCTGCCTGTTCTCTCCGTCGCGGGCACTTTGTCAATAACCTCGGATATTTTCATTGA
TGCCAAAGAACGACTTTATTTCAAAGAACTACTGATGTGTTACCACCACCAGCCGGATAGCATCTAA
ATGTATTTACGGCGTCTTTACGATCTGCCTGTTCTCTCCGTCGCGGGCACTTTGTCAATAACCTCGGATATTTTCATTGA
TGCCAAAGAACGACTTTATTTCAAAGAACTACTGATGTGTTACCACCACCAGCCGGATAGCATCTAA