Detailed information of effector


Summary

Effector ID EFF76648 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS17507 experimental (Type i4a)
Strain Cupriavidus pinatubonensis JMP134
Replicon chromosome
Sequence Protein sequence (208 a.a.); Nucleotide sequence (624 bp)
Description TeoL is an effector protein mainly secreted by T6SS1 and contributes to acquisition of iron from OMVs. TeoL recruits OMVs through binding LPS. During OMV recruitment, the role of TeoL is to tether iron-containing OMVs to specific receptors on the cell surface.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) REUT_RS08685 (teoL)
Coordinates (Strand) 1862145..1862768 (-)
NCBI ID WP_140950547.1
RefSeq NC_007347
Uniprot ID UPI00112D922A
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-207 MLSRCSVADGLPHGRMERFAPDGTRLLEANYVAGKLSGWLRNYDAAGEPVLASHYAGGLLHGPSESYQQGRLACREHYVNGVLEGERSCYGPAGELVAQAVFRRGLLEGEAIWLHEGVVVRRSRFRAGKLEGETRSYAADGTLTLSEPFRADLLHGTARRFDEAGRVSWQRDYTDGKPRGQWRAAAATDNGAAAPSFSQRLERWVRG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9739 - -



  Protein sequence: 208 a.a.    .

>EFF76648 NC_007347:c1862768-1862145 [Cupriavidus pinatubonensis JMP134]
MLSRCSVADGLPHGRMERFAPDGTRLLEANYVAGKLSGWLRNYDAAGEPVLASHYAGGLLHGPSESYQQGRLACREHYVN
GVLEGERSCYGPAGELVAQAVFRRGLLEGEAIWLHEGVVVRRSRFRAGKLEGETRSYAADGTLTLSEPFRADLLHGTARR
FDEAGRVSWQRDYTDGKPRGQWRAAAATDNGAAAPSFSQRLERWVRG*

  Nucleotide sequence: 624 bp    .

>EFF76648 NC_007347:c1862768-1862145 [Cupriavidus pinatubonensis JMP134]
CTGCTGTCGCGCTGTAGCGTGGCCGACGGGCTGCCGCACGGCCGCATGGAGCGCTTCGCCCCGGACGGTACGCGGCTGCT
GGAAGCCAACTATGTAGCGGGCAAGCTGTCGGGCTGGCTGCGCAACTATGACGCGGCCGGCGAGCCGGTGCTGGCTTCGC
ACTATGCCGGCGGCCTGCTCCACGGTCCCAGCGAAAGCTACCAGCAAGGCCGTCTGGCCTGCCGCGAGCACTACGTGAAC
GGCGTGCTCGAAGGCGAGCGCAGCTGCTATGGGCCTGCGGGCGAACTCGTGGCGCAGGCAGTGTTTCGCCGGGGCCTGCT
CGAGGGCGAAGCGATCTGGCTGCACGAAGGCGTGGTGGTGCGGCGCAGCCGCTTCCGTGCCGGCAAGCTGGAGGGCGAGA
CCCGCAGCTATGCGGCGGACGGGACCCTGACGCTGTCCGAGCCCTTTCGCGCCGACCTGCTGCATGGCACCGCACGCCGC
TTCGACGAGGCCGGCCGTGTCAGCTGGCAGCGCGACTACACCGATGGCAAGCCGCGCGGCCAATGGCGCGCTGCGGCCGC
GACCGACAATGGCGCCGCCGCGCCGAGTTTTTCCCAACGCCTCGAGCGCTGGGTCAGGGGCTGA