Detailed information of effector


Summary

Effector ID EFF76635 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00004 experimental (Type i1)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (173 a.a.); Nucleotide sequence (519 bp)
Description His-tag pull-down assay showed that all three proteins were co-eluted with only one 6his-tag at N-ter of TsiV. This indicates that strong interactions exist among the PAAR2 cluster encoded proteins even under the condition of 500?mm NaCl.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA0824 (PAAR2)
Coordinates (Strand) 899138..899656 (-)
NCBI ID NP_249515.1
RefSeq NC_002516
Uniprot ID Q9I5B5_PSEAE
KEGG ID pae:PA0824
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
PAAR_motif PF05488.15 3.4e-16 2..53

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-172 MSGKPAARVTDPTTCPVPGHGSNPIVQGSPDVVFDGLPAARQGDASACGSPMISAVSSTVLINGLPAVTLGSIGAHGNVVIGGSGTVLIGDVFTPAPRAPALPLNRNSVPCSGRFQLIDHETGKPVAGRRVRVWSSGGWNAFDTTDADGMTSWIERPTAEILYIDLVQRCDA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9036 - -



  Protein sequence: 173 a.a.    .

>EFF76635 NC_002516:c899656-899138 [Pseudomonas aeruginosa PAO1]
MSGKPAARVTDPTTCPVPGHGSNPIVQGSPDVVFDGLPAARQGDASACGSPMISAVSSTVLINGLPAVTLGSIGAHGNVV
IGGSGTVLIGDVFTPAPRAPALPLNRNSVPCSGRFQLIDHETGKPVAGRRVRVWSSGGWNAFDTTDADGMTSWIERPTAE
ILYIDLVQRCDA*

  Nucleotide sequence: 519 bp    .

>EFF76635 NC_002516:c899656-899138 [Pseudomonas aeruginosa PAO1]
ATGAGTGGAAAACCCGCCGCCCGCGTCACCGATCCAACGACCTGCCCAGTGCCAGGGCATGGCAGCAACCCCATCGTCCA
GGGCTCTCCCGACGTCGTTTTCGACGGCCTGCCGGCAGCACGGCAAGGCGACGCCTCAGCCTGCGGAAGCCCGATGATCT
CAGCCGTTTCGTCGACGGTACTCATCAACGGCCTGCCGGCGGTGACGCTGGGTAGTATCGGGGCGCACGGCAACGTGGTG
ATCGGCGGCTCGGGGACGGTACTCATCGGCGACGTCTTCACGCCCGCCCCGCGCGCTCCCGCCCTTCCCCTTAACCGCAA
CAGCGTGCCCTGTTCCGGGCGCTTCCAGCTCATCGACCACGAAACGGGCAAGCCCGTCGCCGGACGCCGGGTCAGGGTCT
GGTCGAGTGGCGGCTGGAATGCGTTCGACACCACGGATGCCGACGGCATGACCTCCTGGATCGAGCGCCCCACCGCGGAG
ATCCTCTACATCGACCTGGTGCAGAGGTGCGACGCATGA