Detailed information of effector


Summary

Effector ID EFF76632 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00790 experimental (Type i1)
Strain Vibrio cholerae V52
Replicon chromosome
Sequence Protein sequence (173 a.a.); Nucleotide sequence (519 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VCV52_RS06840 (hcp2)
Coordinates (Strand) 438678..439196 (-)
NCBI ID WP_001142947.1
RefSeq NZ_KQ410498
Uniprot ID H9L4Q3_VIBCH, A0A0X1J838_VIBCO, D7HBV7_VIBCL, A0A0K9V0F0_VIBCL, A0A7U8WQB7_VIBCL, A0A0H3PYB9_VIBCL, C3LMB0_VIBCM, A0A366AGP5_9VIBR, P72350_VIBCL
KEGG ID vcq:EN18_03855, vcz:VAB027_2088, vch:VC_1415, vch:VC_A0017, vcx:VAA049_1881, vcm:VCM66_1370, vcm:VCM66_A0016, vcz:VAB027_1005, vcq:EN18_10295
PDB ID 5MXN, 5OJQ

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 5.3e-35 6..155

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-172 MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHVVTVPTDPQSGQPSGQRVHKPFKFTVALNKAVPLLYNALSSGEKLKTVELKWYRTSIEGKQENFFTTKLENASIVDIHCEMPHCQDPAKSDFTQNVTVSLSYRKITWDHVNAGTSGSDDWRKPIEA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.7783 - -



  Protein sequence: 173 a.a.    .

>EFF76632 NZ_KQ410498:c439196-438678 [Vibrio cholerae V52]
MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHVVTVPTDPQSGQPSGQRVHKPFKFTVALNKAVPL
LYNALSSGEKLKTVELKWYRTSIEGKQENFFTTKLENASIVDIHCEMPHCQDPAKSDFTQNVTVSLSYRKITWDHVNAGT
SGSDDWRKPIEA*

  Nucleotide sequence: 519 bp    .

>EFF76632 NZ_KQ410498:c439196-438678 [Vibrio cholerae V52]
ATGCCAACTCCATGTTATATCTCTATCGAAGGCCAAACTCAGGGTCTTATCACTGCAGGTGCATGTACTGCTGACTCTAT
CGGCGATTCATTCGTTGAAGGCCACGAAGATGAGATGCTGGTTCAGCAGTTTGACCACGTTGTGACTGTACCGACTGACC
CACAATCTGGTCAGCCTTCAGGCCAACGTGTGCACAAGCCATTCAAATTCACTGTGGCGCTGAACAAAGCGGTTCCTCTG
CTGTACAACGCGCTCTCTTCTGGTGAGAAGCTGAAAACCGTTGAGCTGAAGTGGTACCGTACCTCTATCGAAGGTAAACA
AGAGAACTTCTTCACCACTAAGCTGGAAAACGCGTCTATCGTCGACATCCACTGTGAAATGCCACACTGCCAAGACCCAG
CAAAATCTGACTTTACTCAGAATGTGACTGTGTCTCTGTCTTACCGCAAAATCACTTGGGACCACGTTAACGCGGGCACC
TCAGGCTCTGATGACTGGCGTAAGCCAATCGAAGCGTAA