Detailed information of effector


Summary

Effector ID EFF76631 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00790 experimental (Type i1)
Strain Vibrio cholerae V52
Replicon chromosome
Sequence Protein sequence (1164 a.a.); Nucleotide sequence (3492 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VCV52_RS06835 (vgrG1)
Coordinates (Strand) 435059..438550 (-)
NCBI ID WP_000212116.1
RefSeq NZ_KQ410498
Uniprot ID VGRG1_VIBCH, A0A8B0INH1_VIBCO, A0A7U8ZS88_VIBCL, A0A0H3Q601_VIBCL, C3LMB1_VIBCM
KEGG ID vcm:VCM66_1371, vch:VC_1416
PDB ID 4GQK

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
ACD PF16671.7 1.6e-238 726..1111
Phage_GPD PF05954.13 3.9e-77 41..334
Phage_base_V PF04717.14 1.1e-13 392..458

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1163 MATLAYSIEVEGLEDETLVVRGFHGQESLSNSVFLGQACYGFRYEVQLASRVSNLTAEQMVDKRAELKLYRNSQLVQRVHGIVRAFSQGDIGHHHTFYQLTLVPALERLSLRHNSRIFQKQTVPEILSILLQEMGINDYAFALKRDGVQREFCVQYRESDIDFLHRLAAEEGLVYSFVHEAGKHTLYFSDASDSLSKLPEPIPYNALVGGAIDTPYIHGLTYRTQAEVSEVQLKDYSFKKPAYSFLQTVQGTELDYQQTRYQHFDAPGRYKDDVNGAAFSQIRLDYLRRHAHTATGQSNEPLLRAGYKFDLQEHLDPAMNRDWVVVSINHQGEQPQALQEDGGSGATTYSNQFSLIPGHLHWRAEPQPKPQVDGPMIATVVGPEGEEIFCDEHGRVKIHFPWDRYSNGNEQSSCWVRVSQGWAGSQYGFIAIPRIGHEVIVEFLNGDPDQPIITGRTYHATNTPPYTLPEHKTKTVLRTETHQGEGFNELSFEDQAGKEQIYLHAQKDFDGLIENDHTTVIRHDHHLTVENDQFTQIKHNQHLTVEWESREAVTGEQVLSIEGSLHVKTGKVWVNEAGTEIHVKAGQKVVIEAGSEITVKAGGSFVKVDPAGVHLSGALVNLNSGGSAGSGSGFGGAMPALPGGLEPAVALAPPQTISYQALLQAEQANVPAVKVCPLAAQEATPAVNSITPPPPPPIAPPMAPPQPIMNPQPTANAQPNLGRSTKATPDFPTHFPKSSIGIENELAGLVVAMPANSAQKFGYVKSAQGDALFMLTKDMNQGSYQRPPSLQDGKNYQNWQTHTVELVSYPCEMDDKAAVETRKQAMLWLATHFTTHIDQSNHQPLAPIQSEDGRFVIEITNAKHVIAAGNGISAESQGQTITMTPSGQQATVGVAAKGFGTSATPELRLLESAPWYQKSLKSQFASLTSAENLDDKELAANVFAYLTSIYLKTAELAKKFGIYINEWDPMSEQITPNANGLTDPKVKNAWEILPRTKPSKIVEILSKSDAKAVMKHIKPQLQSRYSESLSKNVFQYFQDGGEVAGHGINNATVGDKHSPELAILFEFRTVPNELQSYLPKTESTTKSEVKLLDQFDPMKRKTVIQQVESLVQNSGDAFDKWYQSYRDSMNQPPVKNAKKIASANQKAQWVKEHNPQEWQRIIA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9832 - -



  Protein sequence: 1164 a.a.    .

>EFF76631 NZ_KQ410498:c438550-435059 [Vibrio cholerae V52]
MATLAYSIEVEGLEDETLVVRGFHGQESLSNSVFLGQACYGFRYEVQLASRVSNLTAEQMVDKRAELKLYRNSQLVQRVH
GIVRAFSQGDIGHHHTFYQLTLVPALERLSLRHNSRIFQKQTVPEILSILLQEMGINDYAFALKRDGVQREFCVQYRESD
IDFLHRLAAEEGLVYSFVHEAGKHTLYFSDASDSLSKLPEPIPYNALVGGAIDTPYIHGLTYRTQAEVSEVQLKDYSFKK
PAYSFLQTVQGTELDYQQTRYQHFDAPGRYKDDVNGAAFSQIRLDYLRRHAHTATGQSNEPLLRAGYKFDLQEHLDPAMN
RDWVVVSINHQGEQPQALQEDGGSGATTYSNQFSLIPGHLHWRAEPQPKPQVDGPMIATVVGPEGEEIFCDEHGRVKIHF
PWDRYSNGNEQSSCWVRVSQGWAGSQYGFIAIPRIGHEVIVEFLNGDPDQPIITGRTYHATNTPPYTLPEHKTKTVLRTE
THQGEGFNELSFEDQAGKEQIYLHAQKDFDGLIENDHTTVIRHDHHLTVENDQFTQIKHNQHLTVEWESREAVTGEQVLS
IEGSLHVKTGKVWVNEAGTEIHVKAGQKVVIEAGSEITVKAGGSFVKVDPAGVHLSGALVNLNSGGSAGSGSGFGGAMPA
LPGGLEPAVALAPPQTISYQALLQAEQANVPAVKVCPLAAQEATPAVNSITPPPPPPIAPPMAPPQPIMNPQPTANAQPN
LGRSTKATPDFPTHFPKSSIGIENELAGLVVAMPANSAQKFGYVKSAQGDALFMLTKDMNQGSYQRPPSLQDGKNYQNWQ
THTVELVSYPCEMDDKAAVETRKQAMLWLATHFTTHIDQSNHQPLAPIQSEDGRFVIEITNAKHVIAAGNGISAESQGQT
ITMTPSGQQATVGVAAKGFGTSATPELRLLESAPWYQKSLKSQFASLTSAENLDDKELAANVFAYLTSIYLKTAELAKKF
GIYINEWDPMSEQITPNANGLTDPKVKNAWEILPRTKPSKIVEILSKSDAKAVMKHIKPQLQSRYSESLSKNVFQYFQDG
GEVAGHGINNATVGDKHSPELAILFEFRTVPNELQSYLPKTESTTKSEVKLLDQFDPMKRKTVIQQVESLVQNSGDAFDK
WYQSYRDSMNQPPVKNAKKIASANQKAQWVKEHNPQEWQRIIA*

  Nucleotide sequence: 3492 bp    .

>EFF76631 NZ_KQ410498:c438550-435059 [Vibrio cholerae V52]
ATGGCGACATTAGCGTACAGCATTGAGGTGGAAGGGCTGGAAGATGAGACTCTGGTGGTCAGAGGCTTCCACGGGCAGGA
GTCACTCTCTAATAGTGTTTTTTTAGGGCAAGCCTGTTACGGGTTTCGCTACGAAGTGCAACTGGCGAGTCGGGTATCAA
ACCTCACCGCCGAGCAGATGGTGGATAAGCGTGCCGAGCTCAAGCTTTACCGCAACTCACAGTTGGTGCAGCGCGTGCAC
GGCATTGTGCGTGCTTTCAGCCAAGGCGATATCGGCCATCACCACACCTTCTACCAACTCACTTTAGTCCCTGCCTTAGA
GCGCTTATCCCTGCGTCATAACAGCCGCATTTTCCAAAAGCAGACTGTCCCTGAGATTCTCTCTATCTTGCTGCAAGAGA
TGGGCATCAACGATTACGCTTTTGCGCTCAAACGTGATGGCGTGCAGCGTGAGTTTTGTGTGCAGTACCGCGAAAGCGAT
ATCGACTTTCTGCACCGCCTCGCCGCTGAAGAAGGTTTGGTGTACAGCTTTGTCCATGAAGCGGGCAAACATACCCTCTA
TTTCAGTGATGCCAGTGATAGCCTAAGCAAACTGCCGGAGCCTATCCCATACAACGCTTTAGTCGGTGGCGCGATAGATA
CCCCGTATATCCACGGCTTAACCTATCGCACCCAAGCAGAAGTGAGCGAAGTTCAGCTCAAAGACTACAGCTTCAAAAAG
CCAGCCTACTCCTTTTTGCAAACCGTGCAGGGTACTGAGCTGGATTATCAGCAAACGCGCTACCAACATTTTGATGCGCC
GGGGCGCTACAAAGACGATGTGAACGGCGCCGCCTTTAGCCAAATCCGTTTAGACTACCTGCGCCGCCATGCCCATACCG
CAACAGGGCAGAGCAACGAGCCGCTGCTGCGTGCCGGCTATAAGTTTGACCTGCAAGAGCACCTTGACCCCGCGATGAAC
CGCGATTGGGTGGTAGTGTCGATTAACCACCAAGGTGAGCAGCCGCAAGCGCTACAAGAAGACGGTGGCAGCGGCGCTAC
TACTTACAGCAATCAGTTCAGCTTAATTCCGGGGCATCTTCACTGGCGCGCCGAGCCACAACCCAAACCGCAAGTCGATG
GTCCAATGATTGCCACGGTCGTCGGTCCTGAAGGCGAAGAAATCTTCTGTGATGAACATGGGCGGGTGAAAATCCATTTC
CCGTGGGACCGTTACTCGAACGGTAACGAGCAAAGCTCCTGTTGGGTACGGGTGTCGCAAGGTTGGGCGGGCAGTCAGTA
TGGCTTTATCGCTATTCCGCGCATCGGCCATGAAGTGATTGTAGAGTTTTTAAACGGTGACCCAGACCAACCGATTATCA
CTGGCCGCACTTATCATGCGACCAACACGCCGCCATACACCTTGCCTGAGCACAAAACCAAAACCGTGCTGCGCACCGAG
ACGCACCAAGGGGAGGGCTTTAACGAGCTCAGTTTTGAAGACCAAGCGGGCAAAGAGCAAATCTACCTGCATGCGCAGAA
AGATTTTGATGGTTTGATTGAAAACGACCACACCACGGTCATTCGTCACGACCATCACCTGACCGTTGAAAACGACCAAT
TTACCCAGATTAAGCACAACCAACACCTGACGGTGGAGTGGGAAAGTCGAGAAGCGGTAACGGGCGAGCAAGTGCTGAGT
ATTGAAGGCTCGCTGCATGTGAAAACAGGCAAAGTTTGGGTCAATGAAGCGGGTACAGAGATCCATGTAAAAGCGGGACA
GAAAGTGGTGATTGAAGCGGGCTCCGAGATTACCGTTAAAGCGGGCGGCAGCTTTGTGAAAGTCGATCCGGCTGGGGTGC
ATCTGTCCGGTGCTTTGGTCAATCTCAACTCTGGCGGCAGCGCTGGTAGTGGTAGCGGCTTTGGCGGTGCAATGCCCGCC
TTACCGGGCGGCTTAGAACCCGCCGTGGCACTGGCTCCACCGCAAACCATCTCTTACCAAGCGTTGCTACAGGCCGAGCA
AGCGAATGTTCCTGCGGTGAAGGTGTGTCCTTTAGCCGCTCAAGAAGCAACGCCTGCGGTGAATAGTATCACGCCGCCTC
CACCACCACCGATTGCTCCGCCAATGGCCCCACCACAACCAATAATGAATCCACAGCCAACCGCTAACGCGCAGCCTAAT
CTTGGAAGATCCACTAAGGCAACGCCGGATTTTCCAACACATTTCCCGAAGTCATCCATTGGCATTGAGAATGAGTTAGC
TGGTCTAGTGGTGGCTATGCCAGCCAACTCGGCACAGAAATTTGGCTACGTGAAAAGTGCACAAGGTGATGCGCTGTTTA
TGTTAACGAAAGACATGAACCAAGGTTCGTATCAGCGGCCACCTTCATTACAAGATGGAAAAAATTATCAGAATTGGCAG
ACGCATACAGTAGAGTTGGTGAGCTACCCTTGTGAAATGGACGATAAAGCTGCCGTTGAAACACGCAAACAAGCCATGTT
GTGGTTAGCAACCCACTTTACTACGCATATCGACCAGTCCAATCATCAACCATTAGCTCCTATTCAAAGTGAAGACGGAC
GCTTTGTTATCGAAATCACTAATGCGAAGCATGTGATTGCTGCGGGCAATGGGATTTCTGCAGAATCTCAAGGTCAAACA
ATCACGATGACACCAAGTGGACAACAAGCCACAGTGGGTGTTGCTGCTAAAGGTTTCGGGACGAGTGCAACGCCAGAATT
AAGGTTACTTGAATCGGCACCTTGGTATCAGAAATCACTCAAGAGCCAATTTGCATCTCTAACGAGCGCAGAAAACTTGG
ATGATAAAGAGTTAGCTGCAAACGTATTTGCTTATCTGACGTCTATTTATTTAAAAACAGCAGAGCTAGCGAAGAAGTTT
GGTATTTACATCAATGAATGGGACCCCATGTCGGAGCAAATTACTCCAAATGCGAATGGATTAACGGATCCAAAAGTAAA
AAATGCATGGGAAATATTGCCACGTACAAAACCAAGCAAAATAGTAGAAATACTCAGTAAGAGTGATGCCAAAGCGGTTA
TGAAACATATCAAGCCTCAATTGCAGTCTCGCTATTCTGAGAGTTTGTCGAAAAATGTATTTCAATATTTCCAAGATGGT
GGTGAAGTAGCCGGACACGGTATTAATAATGCGACGGTCGGTGATAAACATAGTCCGGAATTGGCGATTTTGTTTGAGTT
CAGAACTGTTCCGAATGAACTGCAAAGTTATTTGCCTAAAACAGAATCGACAACTAAGTCAGAAGTGAAGTTACTCGATC
AGTTTGATCCTATGAAGCGTAAAACAGTAATTCAACAAGTAGAATCGCTTGTGCAAAATAGTGGCGATGCATTTGATAAA
TGGTACCAAAGCTACCGAGACTCCATGAATCAACCTCCCGTTAAAAATGCGAAGAAAATTGCTTCCGCGAATCAAAAAGC
ACAATGGGTTAAAGAGCATAATCCTCAAGAATGGCAACGCATTATTGCTTAG