Detailed information of effector


Summary

Effector ID EFF76629 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00790 experimental (Type i1)
Strain Vibrio cholerae V52
Replicon chromosome
Sequence Protein sequence (695 a.a.); Nucleotide sequence (2085 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VCV52_RS01480
Coordinates (Strand) 320176..322260 (-)
NCBI ID WP_000212092.1
RefSeq NZ_KQ410497
Uniprot ID UPI0000ED835B
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 1.3e-76 41..334
Phage_base_V PF04717.14 9.7e-14 392..458

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-694 MATLAYSIEVEGLEDETLVVRGFHGQESLSNSVFLGQACYGFRYEVQLASRVSNLTAEQMVDKRAELKIYRNSQLVQRVHGIVRAFSQGDIGHHHTFYELTLVPALERLSLRHNSRIFQKQTVPEILSILLQEMGIHDYAFALKRDCVQREFCVQYRESDIDFLHRLAAEEGLVYSFVHEAGKHTLYFSDASDSLSKLPEPIPYNALAGGTMDTPYIHGLTYRTQAEVSEVQLKDYSFKKPAYSFLQTVQGTELDYQQTRYQHFDAPGRYKDDVNGAAFSQIRLDYLRRHAHTATGQSNEPLLRAGYKFDLQEHLDPAMNRDWVVVSINHQGEQPQALQEEGGSGATTYNNQFSLIPGHLHWRAEPQPKPQVDGPMIATVVGPEGEEIFCDEHGRVKIHFPWDRYSNGNEQSSCWVRVSQGWAGSQYGFIAIPRIGHEVIVSFLNGDPDQPIITGRTYHATNTPPYTLPEHKTKTVLRTETHQGEGFNELSFEDQAGKEQIYLHAQKDFDGLIENDHTTVIRHDQHLTVENDQFTQIKHNQHLTVEGESRTLVKLDCSSEIGGSLQQKIGSKAIYDAGTEVHLKAGNKLVLEAGNELTIKAGGSFIKVDAGGVHVVGSAINLNSGGSAGSGSGYGGKMAELPQGVDKAKTPQEIELAAVTPTQQSMSPLLKARQIEALKGPAPVCEVCEEAKGN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9818 - -



  Protein sequence: 695 a.a.    .

>EFF76629 NZ_KQ410497:c322260-320176 [Vibrio cholerae V52]
MATLAYSIEVEGLEDETLVVRGFHGQESLSNSVFLGQACYGFRYEVQLASRVSNLTAEQMVDKRAELKIYRNSQLVQRVH
GIVRAFSQGDIGHHHTFYELTLVPALERLSLRHNSRIFQKQTVPEILSILLQEMGIHDYAFALKRDCVQREFCVQYRESD
IDFLHRLAAEEGLVYSFVHEAGKHTLYFSDASDSLSKLPEPIPYNALAGGTMDTPYIHGLTYRTQAEVSEVQLKDYSFKK
PAYSFLQTVQGTELDYQQTRYQHFDAPGRYKDDVNGAAFSQIRLDYLRRHAHTATGQSNEPLLRAGYKFDLQEHLDPAMN
RDWVVVSINHQGEQPQALQEEGGSGATTYNNQFSLIPGHLHWRAEPQPKPQVDGPMIATVVGPEGEEIFCDEHGRVKIHF
PWDRYSNGNEQSSCWVRVSQGWAGSQYGFIAIPRIGHEVIVSFLNGDPDQPIITGRTYHATNTPPYTLPEHKTKTVLRTE
THQGEGFNELSFEDQAGKEQIYLHAQKDFDGLIENDHTTVIRHDQHLTVENDQFTQIKHNQHLTVEGESRTLVKLDCSSE
IGGSLQQKIGSKAIYDAGTEVHLKAGNKLVLEAGNELTIKAGGSFIKVDAGGVHVVGSAINLNSGGSAGSGSGYGGKMAE
LPQGVDKAKTPQEIELAAVTPTQQSMSPLLKARQIEALKGPAPVCEVCEEAKGN*

  Nucleotide sequence: 2085 bp    .

>EFF76629 NZ_KQ410497:c322260-320176 [Vibrio cholerae V52]
ATGGCGACATTAGCGTACAGCATTGAGGTGGAAGGGCTGGAAGATGAGACTCTGGTGGTCAGAGGCTTTCACGGGCAGGA
GTCACTCTCCAACAGTGTTTTTTTAGGGCAAGCCTGTTACGGGTTTCGCTACGAAGTGCAACTGGCGAGTCGGGTATCCA
ATCTGACTGCTGAGCAGATGGTGGATAAGCGTGCTGAGCTCAAGATTTACCGCAATTCACAGTTGGTGCAGCGCGTGCAC
GGCATTGTACGTGCTTTCAGCCAAGGCGATATCGGCCATCATCACACCTTCTACGAACTCACTTTAGTGCCTGCCTTAGA
GCGCTTATCCCTGCGCCACAATAGCCGCATTTTCCAAAAGCAGACTGTTCCAGAAATTCTCTCTATCTTGCTGCAAGAGA
TGGGCATCCACGATTACGCTTTTGCGCTCAAACGTGATTGCGTGCAGCGTGAGTTTTGTGTGCAGTACCGTGAAAGTGAT
ATCGACTTTCTGCACCGCCTCGCCGCTGAAGAAGGCTTGGTGTACAGCTTTGTCCATGAAGCGGGCAAACATACCCTCTA
TTTCAGTGATGCCAGTGACAGCCTAAGTAAACTGCCGGAGCCCATCCCGTACAACGCCTTAGCGGGCGGCACGATGGATA
CACCGTACATCCACGGCTTAACCTATCGCACCCAAGCGGAAGTGAGCGAAGTTCAGCTCAAAGATTACAGCTTCAAAAAG
CCGGCGTACTCGTTTTTACAAACCGTGCAGGGTACTGAGCTGGATTATCAGCAAACGCGCTACCAACATTTTGATGCGCC
GGGGCGCTACAAAGACGATGTGAACGGCGCCGCCTTTAGCCAAATCCGTTTAGACTACCTGCGCCGCCATGCCCACACCG
CAACAGGGCAGAGCAACGAGCCGCTGCTGCGTGCCGGCTATAAGTTTGACCTGCAAGAGCATCTTGACCCTGCGATGAAC
CGCGATTGGGTGGTGGTCTCTATTAACCATCAAGGTGAGCAGCCGCAAGCGTTACAAGAAGAGGGCGGCAGTGGTGCAAC
GACCTACAACAACCAGTTCAGCTTAATTCCAGGGCATCTCCACTGGCGCGCCGAGCCACAACCCAAACCGCAAGTCGATG
GTCCAATGATAGCCACGGTCGTCGGTCCTGAAGGCGAAGAAATCTTCTGTGATGAACACGGGCGGGTGAAAATCCATTTT
CCGTGGGACCGCTACTCGAACGGTAACGAGCAAAGCTCCTGTTGGGTACGGGTGTCGCAAGGTTGGGCGGGCAGTCAGTA
TGGCTTTATCGCTATTCCGCGCATCGGTCATGAAGTGATTGTTTCTTTCTTAAATGGCGACCCAGACCAACCGATTATCA
CTGGCCGCACCTATCATGCGACCAATACGCCGCCATACACTTTGCCAGAGCACAAAACCAAAACCGTGCTGCGCACCGAG
ACGCACCAAGGGGAAGGGTTTAACGAGCTCAGTTTTGAAGACCAAGCGGGCAAAGAGCAAATCTACCTGCATGCGCAGAA
AGACTTCGATGGTTTGATTGAAAACGACCACACCACGGTCATTCGCCACGACCAACACCTGACCGTTGAAAACGACCAGT
TCACTCAGATTAAGCACAACCAACACCTGACGGTCGAGGGGGAGAGTCGTACGCTCGTCAAACTCGACTGCAGCAGCGAA
ATCGGCGGTTCATTGCAGCAAAAAATCGGCAGCAAAGCGATTTACGATGCAGGCACAGAGGTTCACCTTAAAGCGGGTAA
CAAACTGGTCTTGGAAGCAGGCAACGAGCTTACCATCAAAGCCGGCGGCAGTTTTATTAAAGTCGATGCTGGCGGTGTGC
ACGTCGTCGGCTCTGCTATTAACCTCAACTCCGGCGGCAGCGCAGGCAGCGGCTCAGGCTATGGCGGTAAAATGGCCGAG
TTGCCACAAGGGGTGGATAAAGCCAAAACGCCGCAAGAGATTGAGCTAGCCGCGGTAACTCCCACTCAGCAGTCTATGTC
GCCTTTACTTAAGGCGCGACAAATTGAAGCACTCAAAGGTCCTGCACCTGTGTGTGAAGTGTGTGAAGAGGCCAAGGGAA
ATTAA