Detailed information of effector


Summary

Effector ID EFF76628 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00790 experimental (Type i1)
Strain Vibrio cholerae V52
Replicon chromosome
Sequence Protein sequence (173 a.a.); Nucleotide sequence (519 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VCV52_RS01485 (hcp2)
Coordinates (Strand) 322388..322906 (-)
NCBI ID WP_001142930.1
RefSeq NZ_KQ410497
Uniprot ID A0A0H3AJT9_VIBC3, D7H8P7_VIBCL, A0A5C2AZI5_VIBCL
KEGG ID vco:VC0395_A1025, vcx:VAA049_1392
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 8.5e-35 6..155

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-172 MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHVVTVPTDPQSGQPSGQRVHKPFKFTVALNKAVPLLYNALSSGEKLKSVELKWYRTSIEGKQENFFTTKLENASIVDIHCEMPHCQDPAKSDFTQNVTVSLSYRKITWDHVNAGTSGSDDWRKPIEA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.7783 - -



  Protein sequence: 173 a.a.    .

>EFF76628 NZ_KQ410497:c322906-322388 [Vibrio cholerae V52]
MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHVVTVPTDPQSGQPSGQRVHKPFKFTVALNKAVPL
LYNALSSGEKLKSVELKWYRTSIEGKQENFFTTKLENASIVDIHCEMPHCQDPAKSDFTQNVTVSLSYRKITWDHVNAGT
SGSDDWRKPIEA*

  Nucleotide sequence: 519 bp    .

>EFF76628 NZ_KQ410497:c322906-322388 [Vibrio cholerae V52]
ATGCCAACTCCATGTTATATCTCTATCGAAGGCCAAACTCAGGGTCTTATCACTGCAGGCGCATGTACTGCTGACTCTAT
CGGCGATTCATTCGTTGAAGGCCACGAAGATGAGATGCTGGTTCAGCAGTTTGACCACGTCGTAACCGTACCGACTGACC
CACAATCTGGTCAGCCTTCAGGCCAACGTGTGCACAAGCCATTCAAATTCACTGTGGCGCTGAACAAAGCGGTTCCTCTG
CTGTACAACGCGCTCTCTTCAGGTGAGAAGCTGAAGTCGGTTGAGCTGAAGTGGTACCGTACTTCTATCGAAGGTAAACA
AGAAAACTTCTTTACCACTAAGCTGGAAAACGCGTCTATCGTCGATATCCACTGTGAAATGCCACACTGCCAAGACCCAG
CAAAATCTGACTTTACTCAGAATGTGACTGTGTCTCTGTCTTACCGCAAAATCACTTGGGACCACGTTAACGCGGGCACC
TCAGGCTCTGATGACTGGCGTAAGCCAATCGAAGCGTAA