Detailed information of effector


Summary

Effector ID EFF28269 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS01034 (Type i1)
Strain Escherichia coli PCN033
Replicon chromosome
Sequence Protein sequence (1394 a.a.); Nucleotide sequence (4182 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PPECC33_RS10745 (Rhs4)
Coordinates (Strand) 2169467..2173648 (-)
NCBI ID WP_047938391.1
RefSeq NZ_CP006632
Uniprot ID UPI00064CA9CA
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF6531 PF20148.1 1.8e-19 46..123
RHS PF03527.16 3.2e-14 1150..1186
RHS_repeat PF05593.16 7.8e-10 575..611
RHS_repeat PF05593.16 1.2e-06 535..568
RHS_repeat PF05593.16 4.1e-05 617..652

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1393 MSGKPAARQGDATMKGGPIVQGSAGVRIGAPTGVACSVCPGGFTSGNPVNPLLGAKVQPGETDFALPGPLPFVLSRTYSSYRTKTPAPVGIFGPGWKAPFDIRLQIRDNELILNDNGGRSIHFEHLFPGEDGFSRSELFWLVRSGVAKLNESHRLAPLWQALPEELRMSPHIYLATNSPQGPWWILGWSERVPGVDEVLPAPLPPYRVLTGLVDRFGRTLTFRREAVGEFTGEITGVTDGAGRQFRLVLTTQAQRAEEAQQQAVAAGAKRPDIPISLPDYTEYGRDNGIRLSAVWLTHDPEYPENLPAAPLVRYDWTPRGELAAVYDRSGTQMRHFTYDDKYRGRMVAHRYAGRPEMRYRYDDIGRVTEQRNPAGLSYTCQYEKNRIIITDSLNRCEVLHTEGEAGLKRVVKKEHADDSVTQSQFDSIGRLQSQTDAAGRTTEYSPNVVTGLVTRITTPDGRKSEFYYNNQNQLTSASGPDGLEMRRKYDEYGRLTQETARNGDITRYSYDNPHSELPSATEDATGSRKQMTWSRYGQLLTFTDCSGYQTRYEYDRFGQMTAVHREEGISRYRRYDNRGRLTSVKDAQGHETRYEYNAAGDLTAVITPDGNRSETQYDAWGKAVSTTQDGLTRSMEYDAAGRVISLTNENGSHSDFSYDALDRLVQQRGFDGRTQRYRYDLTGKLTQNGDEGLVTLWHYDESDRITHRTVNGEPAEQWRYNAHGWLKEISHLSEGHRVAVHYGYNRKGRLTGERQTVHNPETGELLWLHETKHAYNEQGLANRVTPDCLPAVEWLTYGSGYLAGMKLGDTPLLEYARDRLHRETVRSFGSMAGSNAAYELTSTYTPAGQLQSQHLNSLVYDRDYGWNDNGDLVRISGPRQTREYGYSATGRLASVRTLAPDLDISIPYATDPAGNRLPDPELHPDSTLTAWPDNRIAEDAHYLYRYDEYGRLTEKTDRIPAGVIRTDDERTHHYHYDSQHRLVFYTRIQHGEPLVESRYLYDPLGRRMAKRVWRRERDLTGWMSLSRKPEETWYGWDGDRLTTVQTNTTRIQTVYQPGSFTPLIRIETDVTELEKAQRRSLAEKLQQEGSKDGHGVVFPPELVRLLDRLEGEIRADRVSDESRAWLAQCGLTVERLAAQIEPVYLPERKIHLYHCDHRGLPLALISTEGATEWRGEYDEWGNQLNEENPHHLFQPYRLPGQQYDDESGLCYNRYRYYEPLQGRYITQDPIGLNGGWNLYKYPLNPINYADPLGLAVDINHFPVNEDIRNYAEKVWNNPNIITIGTHGDPQSVYDENYNKIDVKTLANEVRNHPKFKPGMSVRLLSCNTGKGNNSYAQQLADELGVRVYAPDQYDWYYSNGKVEPWGGFYDANNQLQMDTNQPGHEFTFKRRRP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.5104 - -



  Protein sequence: 1394 a.a.    .

>EFF28269 NZ_CP006632:c2173648-2169467 [Escherichia coli PCN033]
MSGKPAARQGDATMKGGPIVQGSAGVRIGAPTGVACSVCPGGFTSGNPVNPLLGAKVQPGETDFALPGPLPFVLSRTYSS
YRTKTPAPVGIFGPGWKAPFDIRLQIRDNELILNDNGGRSIHFEHLFPGEDGFSRSELFWLVRSGVAKLNESHRLAPLWQ
ALPEELRMSPHIYLATNSPQGPWWILGWSERVPGVDEVLPAPLPPYRVLTGLVDRFGRTLTFRREAVGEFTGEITGVTDG
AGRQFRLVLTTQAQRAEEAQQQAVAAGAKRPDIPISLPDYTEYGRDNGIRLSAVWLTHDPEYPENLPAAPLVRYDWTPRG
ELAAVYDRSGTQMRHFTYDDKYRGRMVAHRYAGRPEMRYRYDDIGRVTEQRNPAGLSYTCQYEKNRIIITDSLNRCEVLH
TEGEAGLKRVVKKEHADDSVTQSQFDSIGRLQSQTDAAGRTTEYSPNVVTGLVTRITTPDGRKSEFYYNNQNQLTSASGP
DGLEMRRKYDEYGRLTQETARNGDITRYSYDNPHSELPSATEDATGSRKQMTWSRYGQLLTFTDCSGYQTRYEYDRFGQM
TAVHREEGISRYRRYDNRGRLTSVKDAQGHETRYEYNAAGDLTAVITPDGNRSETQYDAWGKAVSTTQDGLTRSMEYDAA
GRVISLTNENGSHSDFSYDALDRLVQQRGFDGRTQRYRYDLTGKLTQNGDEGLVTLWHYDESDRITHRTVNGEPAEQWRY
NAHGWLKEISHLSEGHRVAVHYGYNRKGRLTGERQTVHNPETGELLWLHETKHAYNEQGLANRVTPDCLPAVEWLTYGSG
YLAGMKLGDTPLLEYARDRLHRETVRSFGSMAGSNAAYELTSTYTPAGQLQSQHLNSLVYDRDYGWNDNGDLVRISGPRQ
TREYGYSATGRLASVRTLAPDLDISIPYATDPAGNRLPDPELHPDSTLTAWPDNRIAEDAHYLYRYDEYGRLTEKTDRIP
AGVIRTDDERTHHYHYDSQHRLVFYTRIQHGEPLVESRYLYDPLGRRMAKRVWRRERDLTGWMSLSRKPEETWYGWDGDR
LTTVQTNTTRIQTVYQPGSFTPLIRIETDVTELEKAQRRSLAEKLQQEGSKDGHGVVFPPELVRLLDRLEGEIRADRVSD
ESRAWLAQCGLTVERLAAQIEPVYLPERKIHLYHCDHRGLPLALISTEGATEWRGEYDEWGNQLNEENPHHLFQPYRLPG
QQYDDESGLCYNRYRYYEPLQGRYITQDPIGLNGGWNLYKYPLNPINYADPLGLAVDINHFPVNEDIRNYAEKVWNNPNI
ITIGTHGDPQSVYDENYNKIDVKTLANEVRNHPKFKPGMSVRLLSCNTGKGNNSYAQQLADELGVRVYAPDQYDWYYSNG
KVEPWGGFYDANNQLQMDTNQPGHEFTFKRRRP*

  Nucleotide sequence: 4182 bp    .

>EFF28269 NZ_CP006632:c2173648-2169467 [Escherichia coli PCN033]
ATGAGCGGAAAACCGGCAGCACGTCAGGGCGATGCCACAATGAAAGGTGGCCCGATAGTCCAGGGGTCGGCAGGCGTGAG
GATTGGCGCGCCAACCGGCGTGGCCTGTTCAGTGTGCCCTGGCGGATTCACTTCCGGTAACCCGGTGAATCCGCTGCTCG
GTGCAAAAGTACAGCCCGGCGAAACCGATTTCGCGCTGCCCGGCCCGTTACCGTTCGTGCTCTCCCGCACCTACAGCAGC
TACCGGACGAAAACCCCTGCGCCCGTCGGTATCTTCGGTCCTGGCTGGAAAGCACCCTTTGATATCCGCTTACAGATACG
CGATAACGAACTGATACTCAATGATAACGGTGGCAGAAGCATTCATTTTGAGCACCTGTTTCCCGGTGAGGATGGCTTCA
GCCGCAGCGAATTATTCTGGCTGGTGCGCAGCGGCGTGGCGAAACTGAATGAAAGTCACCGTCTTGCCCCACTCTGGCAG
GCTCTGCCGGAAGAACTCCGCATGAGTCCGCATATTTATCTGGCGACGAACAGTCCTCAGGGGCCGTGGTGGATACTCGG
CTGGAGTGAGCGGGTACCGGGTGTGGATGAGGTGCTGCCTGCGCCATTGCCGCCGTACCGGGTGCTGACCGGCCTGGTGG
ACCGCTTCGGGCGTACCCTGACCTTCCGGCGTGAGGCAGTTGGCGAATTTACCGGGGAAATCACCGGCGTGACCGATGGC
GCAGGCCGTCAGTTCCGCCTGGTGCTGACCACGCAGGCGCAGCGGGCGGAAGAGGCCCAGCAGCAGGCGGTTGCAGCCGG
AGCAAAACGACCAGATATCCCGATTTCATTGCCGGACTATACAGAATATGGCCGGGATAACGGCATCCGCCTGTCAGCGG
TGTGGCTGACGCATGACCCGGAATACCCGGAGAATTTACCTGCCGCGCCACTGGTGCGCTACGACTGGACGCCACGCGGT
GAACTGGCGGCGGTGTATGACCGCAGCGGTACGCAGATGCGCCACTTTACTTACGATGATAAATACCGGGGCCGGATGGT
GGCGCACCGTTACGCAGGCAGGCCGGAGATGCGTTACCGCTACGACGACATCGGGCGCGTGACGGAACAACGTAATCCGG
CGGGTTTAAGCTACACCTGTCAGTATGAGAAAAACCGCATCATCATCACCGACAGCCTGAACCGGTGCGAGGTGCTGCAT
ACAGAAGGCGAAGCCGGGCTGAAACGGGTGGTGAAAAAAGAGCACGCTGACGACAGCGTCACACAGAGTCAGTTCGATTC
CATTGGCCGCCTTCAGTCACAGACGGATGCGGCAGGCCGGACGACAGAATACAGTCCGAATGTGGTGACGGGTCTCGTCA
CACGCATCACCACGCCGGACGGCAGGAAATCGGAATTTTACTATAACAACCAGAACCAGTTAACCTCAGCATCCGGGCCT
GACGGACTGGAAATGCGCAGGAAATATGATGAGTACGGGCGTCTGACGCAGGAAACCGCCCGCAACGGCGATATCACCCG
CTACAGTTATGATAATCCGCACAGTGAATTACCCTCTGCAACTGAAGATGCGACGGGTAGCCGCAAGCAGATGACGTGGA
GCCGTTACGGGCAGTTACTGACCTTCACCGACTGCTCAGGCTACCAGACCCGTTATGAATACGACCGCTTTGGTCAGATG
ACGGCGGTCCACCGCGAGGAAGGTATCAGCCGTTACCGCCGCTATGACAACCGTGGCCGGTTAACCTCGGTGAAAGACGC
ACAGGGCCATGAAACGCGGTATGAGTACAACGCCGCAGGCGACCTGACTGCCGTTATCACCCCGGACGGCAACCGGAGCG
AGACACAGTACGATGCGTGGGGAAAGGCGGTCAGCACCACACAGGACGGGCTGACGCGCAGTATGGAGTATGACGCGGCA
GGACGTGTCATCAGCCTGACCAACGAGAACGGCAGTCACAGCGACTTCAGCTACGATGCGCTGGACCGGCTGGTACAGCA
GCGCGGCTTTGACGGGCGGACGCAACGTTACCGTTACGACCTGACCGGGAAACTCACGCAGAACGGGGATGAGGGGCTTG
TCACCCTCTGGCACTACGACGAATCGGACCGTATCACACACCGCACGGTGAACGGCGAACCGGCAGAGCAGTGGCGGTAT
AACGCCCACGGCTGGCTGAAAGAAATCAGCCACCTGAGCGAAGGTCACCGGGTGGCGGTGCATTACGGCTATAACCGTAA
GGGACGTCTCACCGGCGAGCGCCAGACGGTGCATAACCCTGAGACGGGGGAACTGCTCTGGCTGCATGAGACAAAACACG
CCTACAACGAACAGGGTCTGGCAAACCGCGTCACGCCGGACTGCCTGCCTGCTGTGGAGTGGCTGACCTACGGCAGCGGT
TACCTGGCGGGGATGAAGCTGGGCGACACGCCGCTGCTGGAGTACGCGCGCGACCGCCTGCACAGAGAAACGGTGCGCAG
CTTTGGCAGCATGGCAGGCAGTAATGCCGCATACGAACTGACCAGCACATACACCCCTGCAGGCCAGTTACAGAGCCAGC
ACCTGAACAGCCTGGTGTATGACCGTGACTACGGGTGGAATGACAACGGCGACCTTGTGCGCATCAGCGGCCCGCGACAG
ACGCGGGAATACGGCTACAGTGCCACGGGCAGGCTGGCGAGTGTACGCACCCTCGCACCGGACCTGGATATCAGCATCCC
GTATGCCACCGACCCGGCGGGAAACCGGCTGCCGGACCCGGAGCTGCACCCGGACAGTACACTCACGGCGTGGCCGGATA
ACCGCATCGCCGAAGACGCGCATTACCTGTACCGTTACGATGAATACGGCAGGCTGACGGAGAAGACGGACCGCATCCCG
GCGGGTGTGATACGGACGGACGACGAGCGGACCCACCACTACCACTACGACAGCCAGCACCGTCTGGTGTTCTACACGCG
GATACAGCATGGCGAGCCACTGGTCGAGAGCCGCTACCTCTACGACCCGCTGGGACGGCGAATGGCGAAAAGGGTATGGC
GGCGGGAGCGTGACCTGACGGGGTGGATGTCGCTGTCGCGTAAACCGGAGGAGACATGGTACGGGTGGGACGGCGACAGG
CTGACGACGGTGCAGACTAACACCACGCGTATCCAGACGGTGTACCAGCCGGGAAGCTTCACACCGCTCATCCGCATCGA
AACAGACGTGACCGAACTGGAGAAAGCGCAGCGGCGAAGCCTGGCGGAGAAGTTACAGCAGGAAGGGAGTAAAGATGGTC
ACGGCGTGGTGTTCCCGCCTGAACTGGTGCGGCTGCTGGACAGGCTGGAGGGGGAAATCCGGGCAGACCGTGTGAGTGAC
GAAAGCCGGGCGTGGCTTGCGCAGTGCGGGCTGACGGTGGAGCGGCTGGCGGCACAGATCGAGCCAGTTTATTTGCCTGA
GCGAAAAATACATCTTTATCACTGCGACCACCGGGGACTGCCGCTGGCGCTTATCAGTACTGAAGGTGCAACGGAATGGC
GTGGGGAGTATGACGAGTGGGGGAATCAGCTTAATGAGGAGAACCCGCATCATCTGTTCCAGCCATACCGCCTGCCGGGG
CAGCAGTACGATGATGAATCGGGGCTGTGCTATAATCGTTATCGTTACTACGAGCCGTTACAAGGGAGGTATATTACACA
GGACCCGATTGGGTTAAATGGGGGGTGGAATTTATATAAATATCCGCTGAATCCAATAAATTATGCAGATCCTCTTGGCT
TAGCCGTAGATATAAACCACTTCCCAGTCAACGAAGACATACGAAATTATGCAGAGAAAGTTTGGAATAATCCTAATATC
ATTACAATTGGAACACATGGTGATCCTCAATCAGTATATGATGAAAATTATAATAAGATAGATGTCAAGACATTAGCTAA
TGAGGTTCGAAATCATCCTAAATTTAAACCTGGAATGTCAGTAAGACTGTTATCCTGTAATACAGGAAAAGGAAATAACT
CTTATGCACAGCAATTGGCAGATGAACTAGGTGTGAGAGTCTATGCTCCTGACCAATATGACTGGTACTATTCAAATGGT
AAGGTAGAGCCTTGGGGAGGATTTTATGATGCAAACAATCAATTGCAAATGGACACGAATCAGCCTGGACATGAGTTTAC
ATTCAAGCGAAGGAGACCATAG