Detailed information of effector


Summary

Effector ID EFF28262 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS01034 (Type i1)
Strain Escherichia coli PCN033
Replicon chromosome
Sequence Protein sequence (1421 a.a.); Nucleotide sequence (4263 bp)
Description By detecting the cytotoxicity of these Rhs proteins, in the IPTG-induced group, the survival rates of Rhs-1CT, Rhs-2CT, and Rhs-3CT decreased significantly. Bacteria competition assay shown that Δrhs-1CT, Δrhs-3CT, and Δrhs-4CT play important roles in bacterial competition. After the deletion of rhs-1CT, rhs-2CT, rhs-3CT and rhs-4CT, bacteria adhesion and invasion ability to HBMECs were significantly reduced.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PPECC33_RS01260 (Rhs1)
Coordinates (Strand) 270305..274567 (+)
NCBI ID WP_047938332.1
RefSeq NZ_CP006632
Uniprot ID UPI00064CD0B3
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF6531 PF20148.1 5.9e-17 46..122
RHS PF03527.16 7.4e-15 1157..1194
RHS_repeat PF05593.16 2e-10 582..618
RHS_repeat PF05593.16 5.9e-07 644..681
RHS_repeat PF05593.16 1.4e-06 542..575
RHS_repeat PF05593.16 6e-06 368..398
RHS_repeat PF05593.16 4e-05 416..447
RHS_repeat PF05593.16 5.8e-05 323..360

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1420 MSGKPAARQGDMTQYGGPIVQGSAGVRIGAPTGVACSVCPGGMTSGNPVNPLLGAKVLPGETDLALPGPLPFILSRTYSSYRTKTPAPVGIFGPGWKAPSDIRLQLRDDGLILNDNGGRSIHLEPLLPGEAVYSRSESMWLVRGGKAAQPDGHTLARLWASLPPDIRLSPHLYLATNSAQGPWWILGWSERVPGAEDVLPAPLPPYRVLTGLADRFGRTLTYRREAAGDLAGEITGVTDGAGREFRLVLTTQAQRAEEARKQHTASLFSPDTPRPLSASAFPDTLPGTEYGPDRGIRLSAVWLMHDPAYPESLPGAPLVRYTYTEAGELLAVYDRSNTQVRAFTYDAQHPGRMVAHRYAGRPEMRYRYDDAGRVVEQLNPAGLSYRYQYEQDRITVTDSLNRREVLHTEGGAGLKRVVKKELADGSVTRSGYDPVGRLTAQTDAAGRRTEYGLNVVSGDITDITTPDGRETKFYYNDGNLVTAVVYPDGLESRRAYDERDRLVSETSRSGDVIRYAYDNPHSELPATTTDATGSTRQMTWSRYGQLLAFTDCSGYQTRYEYDRFGQMTAVHREEGISLYRRYDNRGRLTSVKDAQGRETRYEYNAAGDLTAVITPDGNRSETQYDAWGKAVSTTQGGLTRSMEYDAAGRVISLTNENGSHSDFSYDALDRLVQQGGFDGRTQRYHYDLTGKLTQSEDEGLVILWYYDESDRITHRTVNGEPAEQWQYDGHGWLREISHLSEGHRVAVHYGYDDKGRLTGERQTVENPETGELLWQHETKHAYNEQGLANRVTPDSLPPVEWLTYGSGYLAGMKLGGTPLVEYTRDRLHRETVRSFGSMAGSNSAYELTSTYTPAGQLQSQHLNSLVYDRDYGWNDNGDLVRISGPRQTREYGYSATGRLESVRTLAPDLDIRIPYATDPAGNRLPDPELHPDSTLTVWPDNRIAEDAHYVYRHDEYGRLTEKTDRIPAGVIRTDDERTHHYHYDSQHRLVFYTRIQHGEPQVESRYLYDPLGRRTGKRVWRRVRDLTGWMSLSRKPEVTWYGWDGDRLTTIQTQQSRIQTVYEPGSFTPLIRIETDNGEREKTQRRSLAEKLQQEGSEDGHGVVFPAELVRMLDRLEGEIRADRVSSESRQWLAQCGLTVERLAAQIEPVYLPERKIHLYHCDHRGLPLALISTEGATEWRGEYDEWGNLLNEENPHHLHQPYRLPGQQHDEESGLYYNRNRYYDPLQGRYITQDPIGLRGEWNLYKYPLNPVRFIDSLGLKFHVNGDPSDFNQAVEYLKQDSRMKEAIDFLSSSEETIKIEYIDETDVRFDPDKMTIYWNGKAALFCSTDLKSKSQSPALGLGHEFAHAHLYLIDKDGYMGLVRRADEQYKNKEEARVITLIEQHAAKTLGECTRTAYNGVYYRVNTPTQTATINGTPE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.6142 - -



  Protein sequence: 1421 a.a.    .

>EFF28262 NZ_CP006632:270305-274567 [Escherichia coli PCN033]
MSGKPAARQGDMTQYGGPIVQGSAGVRIGAPTGVACSVCPGGMTSGNPVNPLLGAKVLPGETDLALPGPLPFILSRTYSS
YRTKTPAPVGIFGPGWKAPSDIRLQLRDDGLILNDNGGRSIHLEPLLPGEAVYSRSESMWLVRGGKAAQPDGHTLARLWA
SLPPDIRLSPHLYLATNSAQGPWWILGWSERVPGAEDVLPAPLPPYRVLTGLADRFGRTLTYRREAAGDLAGEITGVTDG
AGREFRLVLTTQAQRAEEARKQHTASLFSPDTPRPLSASAFPDTLPGTEYGPDRGIRLSAVWLMHDPAYPESLPGAPLVR
YTYTEAGELLAVYDRSNTQVRAFTYDAQHPGRMVAHRYAGRPEMRYRYDDAGRVVEQLNPAGLSYRYQYEQDRITVTDSL
NRREVLHTEGGAGLKRVVKKELADGSVTRSGYDPVGRLTAQTDAAGRRTEYGLNVVSGDITDITTPDGRETKFYYNDGNL
VTAVVYPDGLESRRAYDERDRLVSETSRSGDVIRYAYDNPHSELPATTTDATGSTRQMTWSRYGQLLAFTDCSGYQTRYE
YDRFGQMTAVHREEGISLYRRYDNRGRLTSVKDAQGRETRYEYNAAGDLTAVITPDGNRSETQYDAWGKAVSTTQGGLTR
SMEYDAAGRVISLTNENGSHSDFSYDALDRLVQQGGFDGRTQRYHYDLTGKLTQSEDEGLVILWYYDESDRITHRTVNGE
PAEQWQYDGHGWLREISHLSEGHRVAVHYGYDDKGRLTGERQTVENPETGELLWQHETKHAYNEQGLANRVTPDSLPPVE
WLTYGSGYLAGMKLGGTPLVEYTRDRLHRETVRSFGSMAGSNSAYELTSTYTPAGQLQSQHLNSLVYDRDYGWNDNGDLV
RISGPRQTREYGYSATGRLESVRTLAPDLDIRIPYATDPAGNRLPDPELHPDSTLTVWPDNRIAEDAHYVYRHDEYGRLT
EKTDRIPAGVIRTDDERTHHYHYDSQHRLVFYTRIQHGEPQVESRYLYDPLGRRTGKRVWRRVRDLTGWMSLSRKPEVTW
YGWDGDRLTTIQTQQSRIQTVYEPGSFTPLIRIETDNGEREKTQRRSLAEKLQQEGSEDGHGVVFPAELVRMLDRLEGEI
RADRVSSESRQWLAQCGLTVERLAAQIEPVYLPERKIHLYHCDHRGLPLALISTEGATEWRGEYDEWGNLLNEENPHHLH
QPYRLPGQQHDEESGLYYNRNRYYDPLQGRYITQDPIGLRGEWNLYKYPLNPVRFIDSLGLKFHVNGDPSDFNQAVEYLK
QDSRMKEAIDFLSSSEETIKIEYIDETDVRFDPDKMTIYWNGKAALFCSTDLKSKSQSPALGLGHEFAHAHLYLIDKDGY
MGLVRRADEQYKNKEEARVITLIEQHAAKTLGECTRTAYNGVYYRVNTPTQTATINGTPE*

  Nucleotide sequence: 4263 bp    .

>EFF28262 NZ_CP006632:270305-274567 [Escherichia coli PCN033]
ATGAGCGGAAAACCAGCGGCGCGTCAGGGAGATATGACTCAGTATGGCGGTCCCATTGTCCAGGGTTCGGCAGGTGTAAG
AATTGGCGCGCCCACCGGCGTGGCGTGCTCGGTGTGTCCGGGCGGGATGACTTCGGGCAACCCGGTAAATCCGCTGCTGG
GGGCGAAGGTGCTGCCCGGCGAGACGGACCTTGCGCTGCCCGGCCCGCTGCCGTTCATTCTCTCCCGCACCTACAGCAGC
TACCGGACGAAGACGCCTGCGCCGGTGGGGATTTTTGGCCCCGGCTGGAAAGCGCCTTCTGATATCCGCTTACAGCTACG
TGATGACGGACTGATACTCAACGACAACGGCGGGCGGAGCATTCACCTTGAGCCGCTGCTGCCGGGGGAGGCGGTGTACA
GCCGCAGCGAGTCAATGTGGCTGGTTCGCGGTGGTAAGGCAGCGCAGCCGGACGGCCACACGCTGGCACGGCTGTGGGCG
TCGCTGCCGCCGGATATCCGGTTAAGCCCGCATCTTTACCTGGCGACCAACAGCGCACAGGGACCGTGGTGGATACTGGG
GTGGTCAGAGCGGGTGCCGGGTGCTGAGGACGTACTGCCAGCGCCGCTGCCGCCGTACCGGGTGCTTACCGGGCTGGCGG
ACCGCTTCGGGCGGACGCTGACGTACCGGCGTGAGGCCGCCGGTGACCTGGCCGGGGAAATCACCGGCGTGACGGACGGT
GCCGGGCGGGAGTTCCGTCTGGTGCTGACCACGCAGGCGCAGCGGGCGGAAGAGGCCCGTAAACAGCACACCGCTTCCTT
ATTTTCCCCTGACACCCCCCGCCCTCTTTCAGCCTCAGCGTTCCCCGACACACTGCCCGGTACCGAATACGGCCCCGACA
GGGGCATCCGTCTTTCGGCGGTGTGGCTGATGCACGACCCGGCATACCCGGAGAGCCTGCCCGGTGCGCCACTGGTGCGG
TACACGTATACGGAAGCCGGTGAACTGCTGGCGGTATATGACCGCAGCAATACGCAGGTGCGCGCTTTCACGTATGACGC
GCAGCACCCGGGCCGGATGGTGGCGCACCGTTACGCGGGAAGGCCGGAGATGCGCTACCGCTACGACGATGCGGGGCGGG
TGGTGGAGCAGCTGAACCCGGCAGGCCTGAGTTACCGCTACCAGTATGAGCAGGACCGCATCACCGTCACGGACAGCCTG
AACCGGCGTGAGGTGCTGCATACAGAAGGCGGGGCCGGGCTGAAGCGGGTGGTGAAAAAAGAACTGGCGGACGGCAGCGT
CACGCGCAGCGGGTATGACCCGGTGGGGCGGCTTACGGCGCAGACGGACGCGGCGGGACGGCGGACAGAGTACGGTCTGA
ATGTGGTGTCAGGCGACATCACGGACATCACCACGCCGGACGGGCGGGAGACGAAATTTTACTATAACGACGGGAACCTG
GTGACGGCGGTGGTGTACCCGGACGGGCTGGAGAGCCGCCGGGCGTATGATGAGCGGGACAGGCTGGTATCGGAGACATC
GCGCAGTGGGGACGTCATCCGGTATGCTTATGATAATCCGCACAGTGAATTACCGGCCACGACAACAGATGCGACGGGCA
GCACCCGGCAGATGACCTGGAGCCGCTACGGTCAGTTGCTGGCGTTCACCGACTGCTCGGGCTACCAGACCCGCTATGAG
TATGACCGCTTCGGCCAGATGACGGCGGTCCACCGCGAGGAAGGCATCAGCCTTTACCGCCGCTATGACAACCGTGGCCG
GTTAACCTCGGTGAAAGACGCACAGGGCCGTGAAACGCGGTATGAATACAACGCCGCAGGCGACCTGACTGCCGTTATCA
CCCCGGACGGCAACCGGAGCGAGACACAGTACGATGCGTGGGGAAAGGCGGTCAGCACCACGCAGGGCGGGCTGACGCGC
AGTATGGAGTATGACGCGGCAGGACGTGTCATCAGCCTGACCAACGAGAACGGCAGTCACAGCGACTTCAGCTACGATGC
GCTGGACCGCCTGGTACAGCAGGGCGGCTTTGACGGGCGGACGCAACGTTATCATTATGACCTGACCGGAAAACTCACGC
AGAGTGAAGATGAGGGGCTTGTCATCCTCTGGTACTACGATGAATCGGACCGTATCACTCACCGCACGGTGAACGGCGAA
CCGGCAGAGCAGTGGCAGTATGATGGCCACGGCTGGCTGAGAGAAATCAGCCACCTGAGCGAAGGCCACCGTGTTGCCGT
CCACTATGGCTATGACGATAAAGGCCGCCTGACCGGCGAACGCCAGACGGTGGAGAACCCGGAGACGGGGGAACTGCTGT
GGCAGCATGAGACGAAACACGCATACAACGAGCAGGGGCTGGCAAACCGCGTCACGCCGGACAGCCTGCCGCCGGTGGAG
TGGCTGACGTATGGCAGCGGTTACCTGGCGGGAATGAAGCTGGGCGGGACGCCGCTGGTCGAGTATACGCGGGACAGGCT
GCACCGTGAGACGGTGCGCAGCTTCGGCAGCATGGCAGGCAGTAATTCCGCATATGAACTGACCAGCACATACACCCCCG
CAGGTCAGTTACAGAGTCAGCACCTGAACAGCCTGGTGTATGACCGTGACTACGGGTGGAATGACAACGGCGACCTGGTG
CGCATCAGCGGCCCGCGACAGACGCGGGAATACGGCTACAGCGCCACGGGCAGGCTGGAGAGCGTGCGCACCCTCGCACC
GGACCTGGACATCCGCATCCCGTATGCCACGGACCCGGCGGGCAACCGGCTGCCGGACCCGGAGCTGCACCCGGACAGTA
CACTCACAGTGTGGCCGGATAACCGCATCGCGGAGGATGCGCACTATGTCTACCGCCACGATGAATACGGCAGGCTGACG
GAGAAGACGGACCGCATCCCGGCGGGTGTGATACGGACGGACGACGAGCGGACCCACCACTACCACTACGACAGCCAGCA
CCGCCTGGTGTTCTACACGCGGATACAGCATGGCGAGCCGCAGGTGGAGAGCCGCTACCTCTACGACCCGCTGGGCCGCC
GGACGGGTAAACGGGTGTGGCGGCGGGTACGTGACCTGACGGGGTGGATGTCGCTGTCGCGTAAACCGGAGGTAACGTGG
TACGGCTGGGACGGTGACAGGCTGACGACGATACAGACACAACAGAGCCGGATCCAGACGGTATACGAGCCGGGAAGCTT
CACACCACTCATCCGCATCGAAACAGACAACGGCGAGCGGGAGAAAACGCAGCGGCGGAGCCTGGCGGAGAAGTTGCAGC
AGGAAGGAAGCGAGGACGGCCACGGTGTGGTGTTCCCGGCAGAACTTGTGAGGATGCTGGACAGGCTGGAGGGGGAAATC
CGGGCAGACCGCGTGAGCAGTGAAAGCCGCCAGTGGCTGGCACAGTGCGGGCTGACGGTGGAGCGGCTGGCGGCACAGAT
AGAGCCGGTTTATTTACCTGAGCGAAAAATTCATCTTTATCACTGTGACCACCGGGGGCTGCCGCTGGCGCTCATCAGTA
CCGAAGGAGCAACGGAATGGCGTGGGGAATATGATGAATGGGGCAACCTGCTGAATGAGGAGAACCCGCATCACCTGCAC
CAGCCATACCGTCTGCCGGGGCAGCAGCATGATGAGGAATCAGGACTGTACTATAACCGGAACCGGTACTATGACCCGCT
ACAGGGAAGGTATATCACCCAGGATCCAATCGGGCTAAGAGGTGAATGGAATCTGTATAAATATCCATTAAACCCTGTTC
GGTTTATAGATTCTTTGGGTTTAAAATTCCATGTTAACGGTGATCCAAGTGATTTTAATCAGGCTGTTGAGTATTTAAAA
CAAGATTCACGAATGAAAGAAGCTATAGATTTTTTATCAAGCTCTGAAGAAACCATAAAGATAGAGTATATTGATGAAAC
CGACGTTAGATTTGACCCGGATAAAATGACTATATATTGGAATGGTAAGGCGGCTTTATTTTGTTCAACTGATTTAAAAT
CGAAATCACAATCACCTGCATTAGGTTTGGGGCATGAGTTTGCTCATGCGCACTTATATCTTATTGATAAGGATGGTTAT
ATGGGGCTTGTGAGACGTGCGGATGAACAATATAAAAATAAAGAAGAGGCGAGAGTTATCACTTTAATTGAACAGCATGC
GGCGAAAACTTTAGGTGAGTGTACCAGAACAGCATATAATGGAGTGTATTATCGTGTGAATACACCAACGCAGACGGCAA
CAATAAATGGCACGCCAGAATAG