Detailed information of effector


Summary

Effector ID EFF01901 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS01300 experimental (Type i4b)
Strain Burkholderia gladioli NGJ1
Replicon chromosome
Sequence Protein sequence (173 a.a.); Nucleotide sequence (519 bp)
Description Western blot analysis revealed that wild-type NGJ1 bacterium is capable of secreting Hcp-1 (that is associated with T6SS-1 cluster) and Hcp-2 (that is associated with T6SS-2 cluster) proteins into extracellular milieu.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) AC179_RS13930 (Hcp-1)
Coordinates (Strand) 95172..95690 (+)
NCBI ID 503461802
GenBank LEKY01000012
Uniprot ID A0A095XG85_BURGA, F2LI26_BURGS
KEGG ID bgd:bgla_1g04100, bgo:BM43_1797
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VipA PF05591.14 3.1e-60 12..163

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-172 MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEVKELPFVVGVVGDLAGQSEVEMPKLRDRKFVNIDRDNFDDVMKAIEPRAAYQVENKLSEEGGKFAVDLKFRSLDDFDPDQVVNQIEPLRRLIEARSKLADLRNKLAGNDKLEDLLSEVLSNTQQLQALAKQSGGGDKEGE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9963 - -



  Protein sequence: 173 a.a.    .

>EFF01901 LEKY01000012:95172-95690 [Burkholderia gladioli]
MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEVKELPFVVGVVGDLAGQSEVEMPKLRDRKFVNIDRDNFDDVMKAIEPR
AAYQVENKLSEEGGKFAVDLKFRSLDDFDPDQVVNQIEPLRRLIEARSKLADLRNKLAGNDKLEDLLSEVLSNTQQLQAL
AKQSGGGDKEGE*

  Nucleotide sequence: 519 bp    .

>EFF01901 LEKY01000012:95172-95690 [Burkholderia gladioli]
ATGGCGAAAAAAGAAAGTATCCAGAAGCGCCTGCAAAAGGTACGGCCGCCCCGTGTGCAGCTGACCTACGAAGTCGAGCG
CGGCGACGCGATCGAGGTGAAGGAACTGCCGTTCGTGGTCGGCGTGGTCGGCGACCTGGCCGGTCAGTCCGAGGTCGAGA
TGCCGAAGCTGCGCGACCGCAAGTTCGTCAACATCGATCGCGACAACTTCGACGACGTGATGAAGGCGATCGAGCCTCGC
GCGGCCTACCAGGTCGAGAACAAACTCAGCGAGGAAGGCGGCAAGTTCGCCGTCGACCTCAAGTTCCGTTCGCTCGACGA
TTTCGATCCGGACCAGGTGGTCAACCAGATCGAACCGCTGCGCCGCCTGATCGAGGCGCGCTCGAAGCTGGCCGACCTGC
GCAACAAGCTGGCCGGCAACGACAAGCTCGAGGACCTGCTGAGCGAAGTGCTCAGCAACACGCAGCAGTTGCAGGCGCTC
GCGAAGCAGTCGGGCGGCGGCGACAAAGAGGGCGAATAA