Detailed information of effector


Summary

Effector ID EFF01898 experimental
Effector type Tle
Cognate immunity protein -
Related T6SS (Type) T6SS01300 experimental (Type i4b)
Strain Burkholderia gladioli NGJ1
Replicon chromosome
Sequence Protein sequence (575 a.a.); Nucleotide sequence (1725 bp)
Description The ectopic expression of selected effector (9tle, 13tle, 23tge, and 12tpe) inhibited the growth of recombinant E. coli (BL21) cells while co-expression with their cognate immunity protein (9tli, 13tli, 23tgi or 12tpi) using different plasmids protected the cells from effector mediated killing.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ACI79_RS26075 (13tle)
Coordinates (Strand) 193895..195619 (+)
NCBI ID 836691417
GenBank LEKY01000069
Uniprot ID UPI00064A956C
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF2235 PF09994.11 3.6e-17 187..322
DUF2235 PF09994.11 1.2e-10 48..172

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-574 MSNAPIIRRITDLTPADDAIRNANREALDPMLIEACKECPKPVWFTAFFDGTGNNYEADGNGSTNIDSTKYSNVAKLWQFAHVADSVMPRTVRRYIEGVGTPCAKVGDSGEGIDGALGMASARKGELRINWMLNELNKHVNSHMPAVSRINVAVFGFSRGATEARAFTRMLTAHLAENVGGKLWWRQTNMKGYRPEVVVYFMGILDTVSSTGFGGSTAETKLEFALGPALGGYLYHINEGGHAAWANDLRIPNYVRQCVHYVATHECREKFPSDSVREDQTLPANCIEQYYPGMHSDVGGGYQRDTQEGRSNELANVPLNNLFIEAWKAGVPLKQPEKVVADSGKLFEISPDLEDLWNVYMAQGSARTTGPEPSGNRLESNVIWHMNRYYQWRASRSRRLHDGRLQPRGGVDHYMAVTDKEWNEDTDQIRRAAGGILTRSISDQWKAIDVASRVTGNWLGTLDPALRQKFDRFFDCYVHDSIAGFKKQMSDSYVGFVEGSRWSVSRRYFMGKRGKKFLYWCYEGDKAEQAATRTAMLDPAKQQPQIAEAGNAQLASNQSATAQPGGSLDSASAA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9801 - -



  Protein sequence: 575 a.a.    .

>EFF01898 LEKY01000069:193895-195619 [Burkholderia gladioli]
MSNAPIIRRITDLTPADDAIRNANREALDPMLIEACKECPKPVWFTAFFDGTGNNYEADGNGSTNIDSTKYSNVAKLWQF
AHVADSVMPRTVRRYIEGVGTPCAKVGDSGEGIDGALGMASARKGELRINWMLNELNKHVNSHMPAVSRINVAVFGFSRG
ATEARAFTRMLTAHLAENVGGKLWWRQTNMKGYRPEVVVYFMGILDTVSSTGFGGSTAETKLEFALGPALGGYLYHINEG
GHAAWANDLRIPNYVRQCVHYVATHECREKFPSDSVREDQTLPANCIEQYYPGMHSDVGGGYQRDTQEGRSNELANVPLN
NLFIEAWKAGVPLKQPEKVVADSGKLFEISPDLEDLWNVYMAQGSARTTGPEPSGNRLESNVIWHMNRYYQWRASRSRRL
HDGRLQPRGGVDHYMAVTDKEWNEDTDQIRRAAGGILTRSISDQWKAIDVASRVTGNWLGTLDPALRQKFDRFFDCYVHD
SIAGFKKQMSDSYVGFVEGSRWSVSRRYFMGKRGKKFLYWCYEGDKAEQAATRTAMLDPAKQQPQIAEAGNAQLASNQSA
TAQPGGSLDSASAA*

  Nucleotide sequence: 1725 bp    .

>EFF01898 LEKY01000069:193895-195619 [Burkholderia gladioli]
ATGAGCAACGCGCCCATCATTCGACGGATCACCGACCTGACGCCCGCCGACGACGCGATTCGCAACGCCAATCGCGAAGC
GCTGGACCCAATGCTCATCGAGGCTTGCAAGGAATGCCCGAAGCCCGTCTGGTTTACGGCGTTCTTCGATGGCACTGGTA
ACAACTACGAAGCCGATGGCAACGGCTCGACGAATATCGACAGTACCAAGTACAGCAACGTGGCCAAGCTATGGCAATTC
GCGCACGTTGCCGACTCGGTCATGCCGCGTACCGTGCGCCGCTATATCGAAGGAGTTGGTACGCCATGCGCGAAAGTTGG
AGATTCCGGCGAAGGCATCGATGGTGCGCTCGGCATGGCCTCGGCCCGCAAGGGCGAGTTGCGGATCAACTGGATGCTCA
ACGAGTTGAATAAGCACGTCAACAGCCACATGCCAGCAGTCAGCCGCATCAATGTAGCGGTATTTGGTTTTTCGCGCGGC
GCCACTGAAGCGCGTGCATTCACACGGATGCTGACGGCGCACCTGGCTGAGAACGTCGGAGGCAAGCTCTGGTGGCGTCA
AACGAACATGAAAGGATATCGCCCGGAAGTGGTGGTCTATTTCATGGGAATCCTCGATACCGTATCCTCGACCGGATTCG
GAGGCAGCACGGCCGAGACGAAACTGGAGTTTGCGCTCGGGCCAGCACTGGGTGGCTATCTTTACCATATCAATGAAGGC
GGACACGCTGCCTGGGCCAACGACCTGCGCATCCCCAACTATGTACGCCAATGTGTGCACTACGTCGCCACCCATGAGTG
TCGTGAGAAGTTTCCGAGCGACTCGGTACGTGAGGATCAAACGCTTCCGGCAAATTGCATCGAACAGTACTATCCAGGGA
TGCACTCGGACGTGGGAGGGGGCTATCAGCGCGATACTCAGGAAGGTCGAAGCAACGAATTGGCCAACGTACCGCTAAAC
AATCTCTTCATCGAAGCATGGAAGGCGGGCGTACCGCTCAAACAACCGGAAAAAGTCGTAGCCGACTCAGGCAAGCTGTT
CGAGATTTCGCCCGATCTCGAAGATCTCTGGAACGTCTACATGGCGCAAGGCAGCGCCCGGACCACCGGCCCTGAGCCAA
GCGGCAACCGCCTTGAGTCGAACGTCATCTGGCACATGAATCGTTACTACCAATGGCGAGCAAGCCGCAGCAGACGCCTG
CATGACGGCCGTCTGCAACCGCGTGGGGGGGTCGATCACTACATGGCAGTCACCGACAAGGAATGGAATGAAGACACCGA
CCAGATTCGCCGCGCCGCCGGAGGCATTCTGACTCGCTCTATTTCCGACCAGTGGAAAGCCATCGATGTGGCAAGCCGAG
TGACGGGAAACTGGCTCGGTACGCTAGACCCTGCACTTCGCCAGAAGTTCGATCGATTTTTTGACTGCTATGTCCATGAC
TCGATTGCCGGTTTCAAGAAGCAGATGTCGGACAGCTATGTCGGCTTCGTGGAGGGGAGCCGCTGGTCGGTGAGCAGGCG
CTATTTCATGGGCAAGCGCGGCAAGAAATTTCTTTACTGGTGCTACGAAGGCGATAAGGCCGAACAGGCTGCCACGCGCA
CTGCGATGCTCGATCCGGCCAAGCAGCAACCTCAAATCGCCGAAGCCGGTAATGCTCAGCTCGCGAGCAACCAATCTGCA
ACGGCGCAACCTGGCGGCTCACTCGACTCGGCATCGGCGGCATGA