Detailed information of effector


Summary

Effector ID EFF01896 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS01301 experimental (Type i3)
Strain Burkholderia gladioli NGJ1
Replicon chromosome
Sequence Protein sequence (168 a.a.); Nucleotide sequence (504 bp)
Description T6SS-2 strain was defective in secretion of Hcp-2 but proficient in secretion of Hcp-1.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) AC179_RS29610 (Hcp-2)
Coordinates (Strand) 57344..57847 (+)
NCBI ID 738096046
GenBank LEKY01000074
Uniprot ID A0A095FFB5_BURGA
KEGG ID bgo:BM43_7145
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 2.4e-27 12..140

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-167 MAFDMHLKFGSGSVTIQGASNHSKHKNEVPIIAWSWGVSNTGNLHTGAGYASGGKANIQDITVTKYIDSCSNAILNACCTGARVDNAYLYVTNATGQQTDFVTIELSEGVLITSVSTGGTGGDERLTENITLHFGKFKYSFQPQDDEGKANGGTKDFTYDIQQVAKQ



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8585 - -



  Protein sequence: 168 a.a.    .

>EFF01896 LEKY01000074:57344-57847 [Burkholderia gladioli]
MAFDMHLKFGSGSVTIQGASNHSKHKNEVPIIAWSWGVSNTGNLHTGAGYASGGKANIQDITVTKYIDSCSNAILNACCT
GARVDNAYLYVTNATGQQTDFVTIELSEGVLITSVSTGGTGGDERLTENITLHFGKFKYSFQPQDDEGKANGGTKDFTYD
IQQVAKQ*

  Nucleotide sequence: 504 bp    .

>EFF01896 LEKY01000074:57344-57847 [Burkholderia gladioli]
ATGGCATTCGACATGCACCTGAAATTCGGCTCCGGTTCGGTCACGATCCAGGGCGCGTCCAACCATTCGAAGCACAAGAA
CGAGGTGCCGATCATCGCGTGGTCGTGGGGCGTGAGCAACACCGGCAACCTGCACACCGGCGCCGGCTACGCCTCGGGCG
GCAAGGCCAACATCCAGGACATCACGGTCACCAAGTACATCGACAGCTGCTCGAACGCGATCCTGAACGCCTGCTGTACC
GGCGCGCGCGTCGACAACGCCTACCTGTACGTGACCAACGCCACCGGCCAGCAGACCGACTTCGTGACCATCGAGCTCAG
CGAAGGCGTGCTGATCACCTCGGTGTCGACCGGCGGCACCGGCGGCGACGAGCGCCTGACCGAGAACATCACGCTGCACT
TCGGCAAGTTCAAGTACTCGTTCCAGCCGCAGGACGACGAGGGCAAGGCCAACGGCGGCACCAAGGACTTCACCTACGAC
ATCCAGCAGGTCGCCAAGCAGTAA