Detailed information of effector


Summary

Effector ID EFF01893 experimental
Effector type Tse
Cognate immunity protein -
Related T6SS (Type) T6SS00005 experimental (Type i4a)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (301 a.a.); Nucleotide sequence (903 bp)
Description Copurification experiments validated the interaction between PA2066 and Hcp2 (10-fold enrichment),PA0256 and Hcp3 (8.4-fold enrichment). PA2066 and PA0256 are bona fide Hcp cargoes and might be H2- and H3-T6SS toxins with antibacterial activity, respectively
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA2056
Coordinates (Strand) 2249693..2250595 (+)
NCBI ID 15597252
RefSeq NC_002516
Uniprot ID Q9I259_PSEAE
KEGG ID pae:PA2056
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
LysR_substrate PF03466.22 2e-31 89..291
HTH_1 PF00126.29 2.2e-20 3..62

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-300 MDLNAVKLLARVAETRSFTQAAVSLGLTQSGLSRAIGRLEAELGVRLLHRTTRSVSLTPDGQLFYERCAPLLAELEEVEKLLVDRQCAPSGPLKITTPQALGRIVIMPVLRELTRCYPQLQIEAAMTDRLVDLTEEGFDAAVRLGRVGDVRLIARPLAALRWVTVASPEYLRGHGTPERLEQLAGHNCPTVRDLHTGKLLEWQFQRDGQPLSLAVRGDLVLDVADALVDAALVGQGIVQVMGFMAEEAIRRRRLVRILQPFEPPLCPVSLIYPPSRQCSLKIGALYEELKSAHWCGALTY



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
TAT(Tat/SPI) 0.7867 pos: 35-36. SRA-IG. MDLNAVKLLARVAETRSFTQAAVSLGLTQSGLSRA



  Protein sequence: 301 a.a.    .

>EFF01893 NC_002516:2249693-2250595 [Pseudomonas aeruginosa PAO1]
MDLNAVKLLARVAETRSFTQAAVSLGLTQSGLSRAIGRLEAELGVRLLHRTTRSVSLTPDGQLFYERCAPLLAELEEVEK
LLVDRQCAPSGPLKITTPQALGRIVIMPVLRELTRCYPQLQIEAAMTDRLVDLTEEGFDAAVRLGRVGDVRLIARPLAAL
RWVTVASPEYLRGHGTPERLEQLAGHNCPTVRDLHTGKLLEWQFQRDGQPLSLAVRGDLVLDVADALVDAALVGQGIVQV
MGFMAEEAIRRRRLVRILQPFEPPLCPVSLIYPPSRQCSLKIGALYEELKSAHWCGALTY*

  Nucleotide sequence: 903 bp    .

>EFF01893 NC_002516:2249693-2250595 [Pseudomonas aeruginosa PAO1]
ATGGACCTGAATGCCGTCAAGTTGCTCGCCCGCGTGGCCGAGACCCGTAGCTTCACCCAGGCCGCCGTTTCTCTCGGTCT
GACCCAGTCCGGCCTGTCGCGCGCCATCGGCCGGCTGGAAGCCGAACTCGGCGTGCGTCTGCTGCACCGCACCACCCGCA
GCGTCAGCCTGACCCCGGACGGCCAGCTGTTCTACGAGCGCTGCGCACCCTTGCTGGCGGAACTGGAGGAAGTCGAGAAG
TTGCTGGTGGACCGCCAGTGCGCGCCGAGCGGTCCGCTGAAGATCACCACCCCGCAGGCGCTCGGGCGGATCGTGATCAT
GCCGGTGCTGCGCGAACTGACGCGGTGCTACCCGCAATTGCAGATCGAGGCGGCGATGACCGATCGCCTGGTCGACCTCA
CCGAGGAAGGCTTCGACGCCGCCGTGCGTCTCGGTCGGGTCGGCGACGTGCGCCTGATCGCCCGGCCATTGGCGGCGTTG
CGCTGGGTCACGGTGGCGTCGCCGGAATACCTGCGTGGCCACGGCACGCCGGAGCGCCTGGAGCAACTCGCCGGGCACAA
CTGCCCGACGGTGCGCGACCTGCATACCGGCAAGCTGCTGGAATGGCAGTTCCAGCGCGACGGCCAGCCGCTGAGCCTGG
CGGTGCGCGGCGACCTGGTGCTGGACGTGGCCGACGCGCTGGTCGACGCGGCGCTGGTCGGCCAGGGCATCGTCCAGGTG
ATGGGCTTCATGGCCGAGGAGGCGATCCGCCGGCGTCGACTGGTACGCATCCTCCAGCCGTTCGAACCGCCGCTGTGCCC
GGTGTCGCTGATCTACCCGCCGTCGCGGCAGTGCTCGCTGAAGATCGGCGCGCTCTACGAGGAACTGAAGAGCGCGCACT
GGTGCGGGGCGCTGACGTACTGA