Detailed information of effector


Summary

Effector ID EFF01892 experimental
Effector type Tse
Cognate immunity protein -
Related T6SS (Type) T6SS00004 experimental (Type i1)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (213 a.a.); Nucleotide sequence (639 bp)
Description Copurification experiments validated the interaction between PA2066 and Hcp2 (10-fold enrichment),PA0256 and Hcp3 (8.4-fold enrichment). PA2066 and PA0256 are bona fide Hcp cargoes and might be H2- and H3-T6SS toxins with antibacterial activity, respectively.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA2066
Coordinates (Strand) 2265126..2265764 (-)
NCBI ID 15597262
RefSeq NC_002516
Uniprot ID Q9I249_PSEAE
KEGG ID pae:PA2066
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF218 PF02698.19 2.5e-14 27..131

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-212 MSPTLQDARLLWDFLGQGRCHVPCELLVVCGSYDLRVCDHACELLERGLAERLLFTGNTGHWTRHLWVEPEAELFARHARARGVSDSLIVIEPRATNFAENIAFARELFPDLRRATFVTKPNSIRRVALTLPVRWPGLEGHVDAPDYAFPDGISNLVGVLGVIDEMVGDLDRIMRYPALGFQVACPIPAQVMDAWERLVARGFDRHLVNPPR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9726 - -



  Protein sequence: 213 a.a.    .

>EFF01892 NC_002516:c2265764-2265126 [Pseudomonas aeruginosa PAO1]
MSPTLQDARLLWDFLGQGRCHVPCELLVVCGSYDLRVCDHACELLERGLAERLLFTGNTGHWTRHLWVEPEAELFARHAR
ARGVSDSLIVIEPRATNFAENIAFARELFPDLRRATFVTKPNSIRRVALTLPVRWPGLEGHVDAPDYAFPDGISNLVGVL
GVIDEMVGDLDRIMRYPALGFQVACPIPAQVMDAWERLVARGFDRHLVNPPR*

  Nucleotide sequence: 639 bp    .

>EFF01892 NC_002516:c2265764-2265126 [Pseudomonas aeruginosa PAO1]
ATGAGCCCGACCCTGCAAGATGCCCGGCTGCTCTGGGACTTCCTCGGCCAGGGCCGCTGCCATGTGCCCTGCGAACTGCT
GGTGGTGTGCGGCTCCTACGACCTGCGGGTCTGCGACCACGCCTGCGAACTGCTCGAACGCGGCCTCGCCGAACGCCTGC
TGTTCACCGGCAACACCGGGCACTGGACGCGCCATCTCTGGGTCGAGCCGGAAGCCGAGCTGTTCGCCCGCCACGCCAGG
GCACGCGGGGTAAGCGACAGCCTCATCGTGATCGAGCCGCGGGCGACCAACTTCGCCGAGAACATCGCCTTCGCCCGCGA
GCTGTTCCCCGACCTGCGCCGCGCGACCTTCGTCACCAAGCCCAACTCGATCCGCCGCGTGGCGCTGACCCTGCCGGTCC
GCTGGCCGGGTCTGGAGGGACACGTGGATGCGCCCGACTACGCATTTCCCGACGGCATCTCGAACCTGGTCGGCGTACTC
GGGGTGATCGACGAGATGGTCGGCGACCTTGACCGCATCATGCGTTACCCGGCGCTGGGCTTCCAGGTCGCCTGCCCGAT
CCCGGCGCAGGTCATGGACGCCTGGGAACGCCTGGTGGCGCGCGGTTTCGACCGCCACCTGGTGAACCCGCCGCGCTGA