Detailed information of effector


Summary

Effector ID EFF01889 experimental
Effector type Tie
Cognate immunity protein -
Related T6SS (Type) T6SS00004 experimental (Type i1)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (252 a.a.); Nucleotide sequence (756 bp)
Description H2-T6SS and the molybdate binding protein ModA are critical for bacterial virulence and T6SS-dependent molybdate acquisition in bacterial competition under anaerobic conditions.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA1863 (ModA)
Coordinates (Strand) 2022411..2023166 (-)
NCBI ID 15597060
RefSeq NC_002516
Uniprot ID Q9I2N2_PSEAE
KEGG ID pae:PA1863
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
SBP_bac_11 PF13531.8 3.4e-44 26..250

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-251 MTTRLPQLLLALLASAVSLAASADEVQVAVAANFTAPIQAIAKEFEKDTGHRLVAAYGATGQFYTQIKNGAPFQVFLSADDSTPAKLEQEGEVVPGSRFTYAIGTLALWSPKAGYVDAEGEVLKSGSFRHLSIANPKTAPYGLAATQAMDKLGLAATLGPKLVEGQNISQAYQFVSSGNAELGFVALSQIYKDGKVATGSAWIVPTELHDPIRQDAVILNKGKDNAAAKALVDYLKGAKAAALIKSYGYEL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.9919 pos: 23-24. ASA-DE. MTTRLPQLLLALLASAVSLAASA



  Protein sequence: 252 a.a.    .

>EFF01889 NC_002516:c2023166-2022411 [Pseudomonas aeruginosa PAO1]
MTTRLPQLLLALLASAVSLAASADEVQVAVAANFTAPIQAIAKEFEKDTGHRLVAAYGATGQFYTQIKNGAPFQVFLSAD
DSTPAKLEQEGEVVPGSRFTYAIGTLALWSPKAGYVDAEGEVLKSGSFRHLSIANPKTAPYGLAATQAMDKLGLAATLGP
KLVEGQNISQAYQFVSSGNAELGFVALSQIYKDGKVATGSAWIVPTELHDPIRQDAVILNKGKDNAAAKALVDYLKGAKA
AALIKSYGYEL*

  Nucleotide sequence: 756 bp    .

>EFF01889 NC_002516:c2023166-2022411 [Pseudomonas aeruginosa PAO1]
ATGACCACCCGCCTGCCCCAGCTATTGCTCGCCCTCCTCGCCAGCGCCGTATCCCTGGCCGCCAGCGCCGACGAGGTGCA
GGTCGCCGTCGCGGCCAACTTCACCGCGCCGATCCAGGCCATCGCCAAGGAATTCGAGAAAGACACCGGGCACAGGCTGG
TCGCCGCCTACGGCGCCACCGGCCAGTTCTATACGCAGATCAAGAACGGCGCGCCGTTCCAGGTGTTCCTCTCCGCCGAC
GACAGCACTCCGGCGAAACTGGAGCAGGAAGGCGAGGTCGTGCCCGGCTCGCGCTTCACCTATGCCATCGGCACCCTGGC
ACTCTGGTCGCCCAAGGCCGGCTATGTCGACGCCGAGGGCGAGGTGCTGAAGAGCGGCAGCTTCAGGCACCTGTCCATCG
CCAACCCGAAGACCGCGCCCTACGGCCTCGCCGCCACCCAGGCGATGGACAAGCTCGGCCTCGCCGCCACGCTCGGGCCG
AAGCTGGTGGAAGGCCAGAACATCAGCCAGGCCTACCAGTTCGTTTCCAGCGGCAACGCCGAACTGGGCTTCGTCGCTCT
GTCGCAGATCTACAAGGATGGTAAAGTCGCAACCGGCTCGGCCTGGATCGTTCCCACCGAGCTGCACGACCCGATCCGCC
AGGACGCGGTCATCCTCAACAAGGGCAAGGACAACGCCGCCGCCAAGGCCCTGGTCGACTACCTGAAGGGCGCCAAGGCC
GCCGCGCTGATCAAGTCCTACGGCTACGAACTCTAA