Detailed information of effector


Summary

Effector ID EFF01887 experimental
Effector type Tse
Cognate immunity protein -
Related T6SS (Type) T6SS00791 experimental (Type i4b)
Strain Edwardsiella tarda PPD130/91
Replicon chromosome
Sequence Protein sequence (174 a.a.); Nucleotide sequence (522 bp)
Description EvpQ is secreted at a T6SS-Dependent manner and facilitates the replication of E. piscicida in blue Gourami Infection Model.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) Y113_RS08110 (EvpQ)
Coordinates (Strand) 41196..41717 (-)
NCBI ID 502611890
RefSeq NZ_JACQ01000015
Uniprot ID D0Z8X5_EDWTE
KEGG ID etr:ETAE_2037
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-173 MDFFYKVEMFNQWRPGVGGVIDLNCGWYCQDALLKWYCKKNYLPSDIFTKTAKCNRMSFGFDPEESFCQKINIINKPEKYKEELLRHGPIIAAIKSRIPGLNLGHYVLIVGVRVKQNEIIIYNPLSINLHSVRKSKPTVMKFKQFMAILEGTLILNQFSVNCAMKMQPLLEPN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9325 - -



  Protein sequence: 174 a.a.    .

>EFF01887 NZ_JACQ01000015:c41717-41196 [Edwardsiella tarda PPD130/91]
MDFFYKVEMFNQWRPGVGGVIDLNCGWYCQDALLKWYCKKNYLPSDIFTKTAKCNRMSFGFDPEESFCQKINIINKPEKY
KEELLRHGPIIAAIKSRIPGLNLGHYVLIVGVRVKQNEIIIYNPLSINLHSVRKSKPTVMKFKQFMAILEGTLILNQFSV
NCAMKMQPLLEPN*

  Nucleotide sequence: 522 bp    .

>EFF01887 NZ_JACQ01000015:c41717-41196 [Edwardsiella tarda PPD130/91]
ATGGATTTTTTCTACAAGGTAGAGATGTTTAACCAATGGAGACCTGGCGTCGGTGGCGTTATTGATCTTAACTGCGGGTG
GTATTGCCAAGATGCGTTGTTAAAATGGTATTGCAAAAAAAACTACTTGCCAAGTGATATCTTCACCAAGACTGCAAAGT
GTAATAGGATGAGCTTCGGCTTTGATCCGGAGGAAAGCTTTTGCCAAAAGATTAACATCATTAATAAGCCAGAAAAATAT
AAAGAAGAGTTACTGCGCCACGGACCCATTATTGCCGCTATAAAGTCAAGAATACCGGGGTTAAACCTTGGGCATTATGT
GCTAATCGTCGGGGTTAGAGTTAAGCAGAATGAGATTATCATATATAACCCGCTAAGTATAAATCTACATAGCGTTAGAA
AATCGAAGCCAACGGTAATGAAGTTTAAACAGTTCATGGCGATCTTGGAAGGCACACTAATCCTTAATCAATTCTCCGTA
AACTGCGCAATGAAAATGCAACCATTGCTTGAGCCAAATTAA