Detailed information of effector


Summary

Effector ID EFF01873 experimental
Effector type Tde
Cognate immunity protein -
Related T6SS (Type) T6SS00258 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (511 a.a.); Nucleotide sequence (1533 bp)
Description The secretion of YPK_0952 was dramatically diminished with deletion of clpV3, but not with deletion of clpV1, clpV2,or clpV4, further indicating that YPK_0952 is a T6SS effector mainly associated with T6SS-3 and contains a typical PAAR domain at its N- terminus and an S-type pyocin domain at its C-terminus.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) YPK_RS04780
Coordinates (Strand) 1067938..1069470 (+)
NCBI ID 499506274
RefSeq NC_010465
Uniprot ID A0A0H3B0Q3_YERPY, Q666X8_YERPS
KEGG ID ypy:YPK_0952, ypo:BZ17_3501, yps:YPTB3116
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Pyocin_S PF06958.14 2.1e-40 269..408
PAAR_motif PF05488.15 8.9e-09 9..54

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-510 MAKGYYLVVGDETTCGGVITEGEPTHTIMGRAVAREQDRITCGKHPGTYIIVGHIPGDTILGRKFAGSLHSTSNCPCKARFIPSMMNDAYELIGSPTSGQSSIAPSFTETSESPPDVTPVFAKSCLREKGCTDAGTEGEPHRNFGKMGFYQTIPPSPTSPTDNNEVDQRAQTARRKPVETEPDVKTPWYKRVLGRTSAAPAAVVVPVSTGAGLAALEQAGIQGMRFVGGNLMTAGRWMVGSSPVGAAIMGMMPGTLNEGETDLLDKLKLENIAKNGGSAPTRVRFRWVDSGNGRLKAEGYHMSAEGGLDRVPVRKMTLNVFTGNYEFWEDGAAGPTILWTPNDPGFKAPSNTGNNDGPIIRTTITVLPMPEADETGEHSTTLPMPEEKDFRDYILIHPLLDLPPLYIYLSKNPDDPIWTERKKITPVQNAYGHWKKHGSEFPELTNSKEYVDATHDFVNNPPDGALNKTRNNGDELFYHPESNTLGIKAKNGAPRTMFKPTDKMDYWNDQ



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9752 - -



  Protein sequence: 511 a.a.    .

>EFF01873 NC_010465:1067938-1069470 [Yersinia pseudotuberculosis YPIII]
MAKGYYLVVGDETTCGGVITEGEPTHTIMGRAVAREQDRITCGKHPGTYIIVGHIPGDTILGRKFAGSLHSTSNCPCKAR
FIPSMMNDAYELIGSPTSGQSSIAPSFTETSESPPDVTPVFAKSCLREKGCTDAGTEGEPHRNFGKMGFYQTIPPSPTSP
TDNNEVDQRAQTARRKPVETEPDVKTPWYKRVLGRTSAAPAAVVVPVSTGAGLAALEQAGIQGMRFVGGNLMTAGRWMVG
SSPVGAAIMGMMPGTLNEGETDLLDKLKLENIAKNGGSAPTRVRFRWVDSGNGRLKAEGYHMSAEGGLDRVPVRKMTLNV
FTGNYEFWEDGAAGPTILWTPNDPGFKAPSNTGNNDGPIIRTTITVLPMPEADETGEHSTTLPMPEEKDFRDYILIHPLL
DLPPLYIYLSKNPDDPIWTERKKITPVQNAYGHWKKHGSEFPELTNSKEYVDATHDFVNNPPDGALNKTRNNGDELFYHP
ESNTLGIKAKNGAPRTMFKPTDKMDYWNDQ*

  Nucleotide sequence: 1533 bp    .

>EFF01873 NC_010465:1067938-1069470 [Yersinia pseudotuberculosis YPIII]
ATGGCAAAAGGTTATTATCTGGTTGTGGGCGATGAAACAACTTGCGGGGGAGTTATCACCGAAGGGGAACCGACCCACAC
AATAATGGGAAGAGCCGTCGCCCGTGAACAAGACCGTATTACCTGCGGTAAGCATCCGGGAACCTACATCATTGTCGGGC
ACATTCCCGGAGACACAATACTGGGACGCAAGTTTGCGGGTTCACTACACAGCACAAGTAACTGTCCGTGCAAGGCAAGA
TTTATCCCTTCGATGATGAATGATGCCTATGAGTTAATCGGGTCACCTACCTCCGGTCAGTCCAGTATCGCACCCTCATT
CACGGAGACCTCCGAATCACCACCAGACGTAACCCCCGTTTTTGCCAAGTCTTGTCTGCGGGAAAAGGGGTGTACCGATG
CGGGTACCGAGGGTGAACCACACCGCAATTTCGGCAAAATGGGCTTTTATCAGACTATTCCCCCCTCACCAACCTCCCCA
ACTGATAATAATGAAGTGGATCAACGCGCTCAAACTGCCAGGCGTAAACCTGTGGAAACAGAGCCTGATGTTAAGACACC
GTGGTACAAGCGGGTGTTGGGGAGAACCAGTGCGGCTCCGGCCGCGGTAGTTGTACCGGTATCGACTGGGGCGGGTCTGG
CGGCCTTAGAGCAAGCGGGTATTCAGGGAATGCGGTTTGTCGGTGGTAACCTGATGACGGCGGGACGCTGGATGGTGGGT
TCATCACCTGTCGGTGCTGCTATCATGGGAATGATGCCGGGCACCCTGAATGAAGGTGAAACCGATTTACTCGACAAACT
CAAGCTGGAAAACATTGCTAAGAATGGTGGCTCAGCACCAACACGCGTGCGTTTTCGCTGGGTTGATAGCGGAAATGGCC
GGTTAAAAGCCGAGGGCTATCATATGAGTGCTGAAGGTGGATTGGACAGAGTGCCAGTACGCAAGATGACGCTCAATGTC
TTTACCGGCAATTATGAGTTTTGGGAAGATGGCGCGGCAGGGCCAACCATTCTGTGGACACCGAATGATCCCGGATTTAA
AGCCCCATCGAATACCGGTAATAACGACGGGCCGATCATTCGCACTACGATTACGGTATTACCGATGCCGGAAGCTGACG
AAACCGGCGAGCATTCAACTACATTACCCATGCCAGAGGAGAAGGATTTCCGCGATTATATTCTGATCCATCCGTTGCTT
GATTTGCCACCGTTGTATATCTATCTCAGTAAAAATCCAGATGATCCTATCTGGACTGAAAGAAAGAAAATAACTCCGGT
TCAAAATGCATATGGACATTGGAAAAAACATGGTTCTGAATTTCCAGAACTAACTAATTCGAAAGAGTATGTCGATGCGA
CTCACGATTTTGTTAACAACCCTCCGGATGGGGCGCTAAACAAAACTAGAAACAATGGAGACGAGCTTTTTTATCATCCA
GAAAGTAATACATTGGGGATTAAAGCAAAAAATGGTGCCCCAAGGACTATGTTTAAACCAACCGATAAAATGGACTATTG
GAACGATCAATGA