Detailed information of effector


Summary

Effector ID EFF01867 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS01103 experimental (Type i5)
Strain Agrobacterium tumefaciens strain 1D1609
Replicon chromosome
Sequence Protein sequence (202 a.a.); Nucleotide sequence (606 bp)
Description Hcp and Tae were detected in the media fraction of each strain while Hcp was not detected in the media fractions of any of the ΔtssL mutants but could be detected in the media fractions of mutant strains complemented with their cognate tssL gene
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) At1D1609_RS22470
Coordinates (Strand) 1478708..1479313 (+)
NCBI ID 1349686563
RefSeq NZ_CP026925
Uniprot ID A0A2L2LJ91_RHIRD
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF4150 PF13665.8 4.9e-33 35..141

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-202 MSIPRDNYIGEPQYPGTWTTATPREGLRDIDEARIVSLAPDVCLTPVGSSVVPIPYPVVDFCGHDKNYTPSVRFTGKKAMVMRSFTTHVHGDAPGNRKGVKSGTVESICEPIGHADQVRAEGSHVIRHLDRFYMNSRNTQGEAIFVRSTQTYDPPKDDDPVRGSLRWQDGSDEGRVMSDASPEPLIMGAQYAQAQTATIPQS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9773 - -



  Protein sequence: 202 a.a.    .

>EFF01867 NZ_CP026925:1478708-1479313 [Agrobacterium tumefaciens]
MSIPRDNYIGEPQYPGTWTTATPREGLRDIDEARIVSLAPDVCLTPVGSSVVPIPYPVVDFCGHDKNYTPSVRFTGKKAM
VMRSFTTHVHGDAPGNRKGVKSGTVESICEPIGHADQVRAEGSHVIRHLDRFYMNSRNTQGEAIFVRSTQTYDPPKDDDP
VRGSLRWQDGSDEGRVMSDASPEPLIMGAQYAQAQTATIPQS

  Nucleotide sequence: 606 bp    .

>EFF01867 NZ_CP026925:1478708-1479313 [Agrobacterium tumefaciens]
ATGAGCATCCCCCGCGACAATTATATCGGAGAGCCCCAATATCCCGGCACATGGACCACGGCGACACCGCGTGAGGGACT
GCGTGACATCGATGAGGCGCGTATCGTCTCTTTGGCGCCTGATGTATGCCTGACACCGGTTGGCTCGTCGGTGGTGCCTA
TTCCCTATCCGGTCGTGGATTTTTGCGGCCATGATAAAAACTACACGCCGTCTGTTCGGTTCACCGGCAAAAAGGCAATG
GTGATGCGTTCGTTTACGACACATGTGCACGGCGACGCGCCCGGTAACCGTAAGGGGGTAAAATCCGGCACGGTGGAAAG
CATCTGCGAACCCATCGGGCACGCTGATCAGGTGCGTGCCGAAGGCTCGCATGTCATTCGCCACCTCGATCGTTTTTATA
TGAACAGCAGGAATACCCAGGGTGAGGCGATCTTCGTCCGCAGCACGCAGACCTATGATCCTCCCAAGGACGATGATCCG
GTGCGGGGATCGCTCCGATGGCAGGACGGGTCGGACGAAGGCCGGGTTATGAGCGATGCGTCGCCCGAGCCGTTGATCAT
GGGTGCGCAGTATGCGCAGGCTCAGACCGCTACCATTCCTCAAAGC